KEGG   Acidiphilium multivorum: ACMV_19450Help
Entry
ACMV_19450        CDS       T01446                                 

Gene name
arcA
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
amv  Acidiphilium multivorum
Pathway
amv00220  Arginine biosynthesis
amv00330  Arginine and proline metabolism
amv01100  Metabolic pathways
amv01110  Biosynthesis of secondary metabolites
amv01130  Biosynthesis of antibiotics
amv01230  Biosynthesis of amino acids
Module
amv_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    ACMV_19450 (arcA)
   00330 Arginine and proline metabolism
    ACMV_19450 (arcA)
Enzymes [BR:amv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     ACMV_19450 (arcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: BAJ81292
NITE: ACMV_19450
UniProt: F0IZT2
Position
2166189..2167148
Genome map
AA seq 319 aa AA seqDB search
MVTEEQSMMQRKQCRLIGVPVQDGAGRPGCEMGPSAFRAAGIASAIRDLGHAVDDLGNIA
PRPTASKPHGNGTVKCLPEVAGWTSSLAEAAYSAFDAEDAFPVCLGGDHSLAAGSLTGLA
RRAAERQREFFVLWLDAHPDLHTLDTTRSGNLHGVPMAYATGQAGFEGYFPPAAARIRPE
NVCMLGIRSVDPAEQRILEGAGITVYDMRAIDEHGVVPLLRDFLARVAAANGHLHVSLDV
DFLDPAIAPGVGTTVPGGATFREAHLVMEMLHDSGLVGSVDLVELNPFLDERGRTAILMV
DLLASLLGRRVLDYPTRSF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggtgacggaggagcaatcgatgatgcagcggaagcaatgccggctgatcggtgttccg
gtgcaggatggcgccggcaggcctggttgcgagatggggccgagcgcgttccgagccgca
ggaatcgcgagcgccatccgcgatctcggtcacgcggtggacgatctcggcaatatcgca
ccccgtccgacagcatcgaagccgcatggcaacggcacggtgaagtgcctgccggaggtt
gccggatggacgtcttctctggccgaggctgcctattcggcattcgatgccgaggatgcc
tttccggtctgcctcggcggcgatcacagtctcgctgccgggtcgctgaccggcctggcc
cgccgggcggcggagcggcagcgcgaattcttcgtgctctggctcgacgcccatcccgat
ctccacacgctcgatacgacccgaagcggcaacctgcacggcgttccgatggcctatgcc
accgggcaggctgggttcgagggctatttcccgccggccgcggcacgcatccgtccggaa
aatgtctgcatgctcggcatccgcagcgtcgatccggcggagcagcgcatcctggaaggc
gccggcatcacggtttacgacatgcgcgccatcgacgagcacggcgtcgtccccctgctg
cgtgactttcttgccagggtggcggcggcgaacggccacctgcatgtcagcctcgacgtc
gatttccttgacccagcaatcgcgcccggcgtcggcaccacggttcccggcggggccacc
ttccgcgaggcgcatctggtgatggagatgctgcacgacagcggcctggtcggcagcgtc
gacctcgtcgaactcaatccctttctcgatgaacgcggccgcaccgccatcctgatggtg
gacctgctggccagcctgctcggccgccgcgtgctcgactatcccacacggagcttctga

DBGET integrated database retrieval system