KEGG   Acidiphilium multivorum: ACMV_21210Help
Entry
ACMV_21210        CDS       T01446                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
amv  Acidiphilium multivorum
Pathway
amv00020  Citrate cycle (TCA cycle)
amv00190  Oxidative phosphorylation
amv00650  Butanoate metabolism
amv01100  Metabolic pathways
amv01110  Biosynthesis of secondary metabolites
amv01120  Microbial metabolism in diverse environments
amv01130  Biosynthesis of antibiotics
amv01200  Carbon metabolism
Module
amv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
amv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
amv_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACMV_21210 (sdhD)
   00650 Butanoate metabolism
    ACMV_21210 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ACMV_21210 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS DUF4271
Motif
Other DBs
NCBI-ProteinID: BAJ81468
NITE: ACMV_21210
UniProt: F0J0A8
Position
2352065..2352433
Genome map
AA seq 122 aa AA seqDB search
MRSALGRARGMGAAKSGVHHWWAQRLTALALLPLALYAVLSVLLLEGASQAEMLRYMAEP
WNGVLFLALVIALFYHLQLGLQVVIEDYIRSEGKRLAVMLAMRATAGFFGLLAIISVLKL
SF
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcggcactcggccgcgcccgcggcatgggggccgcgaaatcgggcgtgcatcac
tggtgggcgcagcggctgaccgcgctggcgctgctgccgctcgcgctctacgccgtgctg
tcggtgctgctgctggagggcgcgagccaggccgagatgctgcgctacatggccgagccg
tggaacggggtgctgttcctcgccctcgtgatcgcgctgttctatcacctgcagctgggt
ttgcaggtggtgatcgaggactacatccgctccgagggcaagcggctcgcggtcatgctc
gcgatgcgggcgacggccgggttcttcgggctgctggccatcatctcggtcctgaaactg
tccttctga

DBGET integrated database retrieval system