KEGG   Acidiphilium multivorum: ACMV_23450Help
Entry
ACMV_23450        CDS       T01446                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
amv  Acidiphilium multivorum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ACMV_23450
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ACMV_23450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(2603316..2603687)
Genome map
AA seq 123 aa AA seqDB search
MKSTLLIAVAAGAFCIASAQAANVAHGKALFQAQCAACHSVSPGQNGIGPSLAGVYGAKA
AATPGFQFSPALKKSGIVWNASTLDKFLANPQADVPGTKMPYMGMANATDRADVVAYLQT
LGK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccactcttctcatcgccgttgccgcgggtgcattctgcatcgcgagcgcgcag
gcggcgaacgtggcacatggcaaggcactgtttcaggcccagtgcgcagcctgccatagc
gtgagcccggggcagaacgggatcggcccgtcattggcgggcgtctacggcgcgaaggcc
gctgcgaccccgggattccagttctccccggcgctcaagaagtccggaatcgtgtggaac
gcctcgacgctcgacaagttcctggccaatccgcaggcggatgtgccgggcaccaagatg
ccctatatgggcatggccaatgccaccgatcgggccgacgtggtcgcctatctgcagacg
ctcggcaaataa

DBGET integrated database retrieval system