KEGG   Acidiphilium multivorum: ACMV_27230Help
Entry
ACMV_27230        CDS       T01446                                 

Definition
(RefSeq) hypothetical protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
amv  Acidiphilium multivorum
Brite
Enzymes [BR:amv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     ACMV_27230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2994253..2995332
Genome map
AA seq 359 aa AA seqDB search
MQQVINRSPLSDNAPDDDSNVAIIGVAQAVWAEMALHGIVPTPHAYEICFAYRRGDNPTL
CDFIDQHHPNLANLTPDAIESLHARFFNDSSVSEDLASNVLGLQEAADTLVGHITGNQSA
LRDYGDTLAGWAKRLDHEPTIASLVAAVAALTAETTRAAARNRALEEKLANSVQRINRLR
QSLSVARAEATTDSLTAITNRRAFDTKARRFITQTRGAAPLVACLVLFDIDNFKWFNDVH
GHQTGDLILRLVARLLSDSVKGRDTVARYGGEEFAVLLAGADLRSAISVARQICQSMADR
KLVKRSSGQQLTQVTLSAGVAQFIGGENLASWVSRADAALYRAKELGRNRVCSELDLAG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaggtgatcaaccggtctcctctttctgacaacgcgcccgacgacgacagcaat
gtcgcgatcatcggcgtcgcgcaggccgtctgggccgagatggcgctgcatggcatcgtg
ccgacgccgcacgcctatgagatctgtttcgcctatcgcaggggcgacaacccgaccctt
tgcgactttatcgaccagcaccacccgaatcttgcgaacctcacgccggacgcgatcgag
tcgctgcacgcgcgcttcttcaatgactcgtccgtcagcgaggacctcgcgagcaacgtg
ctgggtctgcaggaagccgcggacacgcttgtcggccatatcaccggcaatcagtccgcg
ctcagggactatggcgacacgctcgccggctgggcgaaacgcctcgaccatgagccgacc
atcgcgagtctcgttgccgcggtcgcggcgctgacggcggaaaccacccgcgccgccgcg
cgcaaccgtgcgctcgaggaaaaactcgcgaactcggtccagcggatcaaccggctaagg
cagtccctcagcgtcgcccgggcggaagccaccaccgattccctgacggccatcaccaac
cgccgcgccttcgacaccaaggcacggcggttcatcacccagacgcgcggcgcggccccg
ctcgtcgcctgcctcgtcctgttcgatatcgacaacttcaaatggttcaacgacgtccat
ggccaccagaccggtgacctgatcctccgcctcgtcgcgcgcctgctgtccgacagcgtc
aagggccgcgacaccgtcgcccgctatggcggcgaggaattcgcggtgctgctcgccgga
gcggatctcagatcggccatttccgtggcacggcagatctgccagtcgatggccgatcgc
aaactggtcaagcgttcctcgggccagcagctgacccaggttaccctgtccgccggcgtc
gcccagttcatcggcggcgaaaacctcgcgagctgggtcagccgcgcagatgcggcactc
taccgggccaaggaactcggccgcaaccgcgtctgcagcgaactcgacctggccggctga

DBGET integrated database retrieval system