KEGG   Acidiphilium multivorum: ACMV_27230Help
Entry
ACMV_27230        CDS       T01446                                 

Definition
hypothetical protein
Orthology
K13590  
diguanylate cyclase
Organism
amv  Acidiphilium multivorum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
2994253..2995332
Genome map
AA seq 359 aa AA seqDB search
MQQVINRSPLSDNAPDDDSNVAIIGVAQAVWAEMALHGIVPTPHAYEICFAYRRGDNPTL
CDFIDQHHPNLANLTPDAIESLHARFFNDSSVSEDLASNVLGLQEAADTLVGHITGNQSA
LRDYGDTLAGWAKRLDHEPTIASLVAAVAALTAETTRAAARNRALEEKLANSVQRINRLR
QSLSVARAEATTDSLTAITNRRAFDTKARRFITQTRGAAPLVACLVLFDIDNFKWFNDVH
GHQTGDLILRLVARLLSDSVKGRDTVARYGGEEFAVLLAGADLRSAISVARQICQSMADR
KLVKRSSGQQLTQVTLSAGVAQFIGGENLASWVSRADAALYRAKELGRNRVCSELDLAG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaggtgatcaaccggtctcctctttctgacaacgcgcccgacgacgacagcaat
gtcgcgatcatcggcgtcgcgcaggccgtctgggccgagatggcgctgcatggcatcgtg
ccgacgccgcacgcctatgagatctgtttcgcctatcgcaggggcgacaacccgaccctt
tgcgactttatcgaccagcaccacccgaatcttgcgaacctcacgccggacgcgatcgag
tcgctgcacgcgcgcttcttcaatgactcgtccgtcagcgaggacctcgcgagcaacgtg
ctgggtctgcaggaagccgcggacacgcttgtcggccatatcaccggcaatcagtccgcg
ctcagggactatggcgacacgctcgccggctgggcgaaacgcctcgaccatgagccgacc
atcgcgagtctcgttgccgcggtcgcggcgctgacggcggaaaccacccgcgccgccgcg
cgcaaccgtgcgctcgaggaaaaactcgcgaactcggtccagcggatcaaccggctaagg
cagtccctcagcgtcgcccgggcggaagccaccaccgattccctgacggccatcaccaac
cgccgcgccttcgacaccaaggcacggcggttcatcacccagacgcgcggcgcggccccg
ctcgtcgcctgcctcgtcctgttcgatatcgacaacttcaaatggttcaacgacgtccat
ggccaccagaccggtgacctgatcctccgcctcgtcgcgcgcctgctgtccgacagcgtc
aagggccgcgacaccgtcgcccgctatggcggcgaggaattcgcggtgctgctcgccgga
gcggatctcagatcggccatttccgtggcacggcagatctgccagtcgatggccgatcgc
aaactggtcaagcgttcctcgggccagcagctgacccaggttaccctgtccgccggcgtc
gcccagttcatcggcggcgaaaacctcgcgagctgggtcagccgcgcagatgcggcactc
taccgggccaaggaactcggccgcaaccgcgtctgcagcgaactcgacctggccggctga

DBGET integrated database retrieval system