KEGG   Acidiphilium multivorum: ACMV_27390Help
Entry
ACMV_27390        CDS       T01446                                 

Gene name
holC
Definition
putative DNA polymerase III chi subunit (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
amv  Acidiphilium multivorum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:amv00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:amv00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:amv03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:amv03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:amv03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3013881..3014348
Genome map
AA seq 155 aa AA seqDB search
MAQLGFYHLTRTGLEAALPALLARTLAAGARAVVRGTDPARIEALDAALWLAPGVDWLPH
GTAAMGHGPDQPVWLTTGDDVPNDARFLFLVDGATADLARFERVFDLFDGNDPDAVAAAR
ARWKAARAAGHALTYWQQGETGWIRQAEVAPETSR
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctcggcttctaccacctgacgcgcaccgggctggaggccgccctgcccgcc
ctgctcgcccgcaccctcgccgccggcgcgcgggcggtggtgcgcggcaccgatcccgcc
cggatcgaggcgctggacgccgccctctggctcgcgccgggggtggactggctgccgcac
ggcaccgccgcgatgggtcatggccccgaccagccggtctggctcaccaccggcgacgac
gtgccgaacgacgcgcggttcctgttcctggtggatggcgcgacggcggatctcgcccgc
ttcgagcgggtgttcgacctgttcgacggcaacgaccccgatgcggtggccgccgcgcgc
gcccgctggaaggccgcgcgcgccgccggccacgcgctgacctactggcagcagggcgag
accggctggatcaggcaggcggaagtcgcgccggaaacctcgcgttaa

DBGET integrated database retrieval system