KEGG   Acidiphilium multivorum: ACMV_28820Help
Entry
ACMV_28820        CDS       T01446                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
amv  Acidiphilium multivorum
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ACMV_28820 (dxr)
Enzymes [BR:amv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     ACMV_28820 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3152421..3153596
Genome map
AA seq 391 aa AA seqDB search
MAVKTVTILGSTGSVGTQTIDLLQADPENYRVRALIAGRNAALLAEQARSLHAEIAVIAD
ESAFPALRDALAGSGIRAEAGRAAVIAAAAEPADWTMAAITGTAGLEPTLAATRNGGAIA
LANKEALVSAGDVFLAAIAAGGATLLPVDSEHNAIFQSLADGNRAALEKIILTASGGPFR
EASLDEMKDATPETALKHPVWSMGAKISIDSATLFNKGLEVIEAARIFGLAPHEIEVLVH
PQSIVHGMVCYRDGSVLAQMGAPDMRIPIAHTLAWPARLATSSPRLDLAAAARLDFLAPD
PVRFPALRLAREALEAGHGASTVLNAANEIAVEAFLRRRIGFLDITAVVERVMQRLGAPP
IGDLAAVLALDAEARAMAEAELRAKSDPRAA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgaagacagtcacgatcctcggctcgaccggcagcgtcggcacccagaccatc
gacctgctgcaggcggatcccgaaaactatcgggtccgtgcgctgatcgccgggcgaaac
gccgccctgctcgccgagcaggcccgctcgctgcacgccgagatcgccgtcattgctgac
gagagcgccttccccgccctgcgcgacgcgctggccggcagcggcatccgcgccgaggcc
ggccgcgccgccgtgatcgccgccgccgccgagccggccgactggacgatggccgcgatc
accggcaccgccggcctcgaacccaccctcgccgcgacccgcaacggtggggccatcgcg
ctcgccaacaaggaggcgctggtttccgccggcgacgtgttccttgccgcgatcgccgcc
ggcggagcgacgctgctgccggtcgattccgaacacaacgccatcttccagtcgctcgcc
gacggcaaccgcgccgctctggaaaagatcatcctcaccgcttcgggcggcccgttccgg
gaagcaagcctcgacgagatgaaggacgcgacgccggagaccgcgctgaagcatcccgtc
tggtcgatgggtgcgaagatctcgatcgattccgccaccctcttcaacaaggggctggag
gtgatcgaggccgcgcgcatcttcggcctcgcgccgcatgagatcgaggtgctggtgcat
ccgcagtcgatcgtgcatggcatggtctgctatcgcgacggatcggtgctggcccagatg
ggcgcgccggacatgcgcatcccgatcgcccacaccctggcctggccggcgcgcctcgcg
acctcctcgccccggctcgacctcgccgccgcggcgcggctcgacttccttgcccccgat
ccggtgcgcttcccggcgctccgtcttgcgcgcgaggcactggaagccggccatggcgcc
tcgacggtgctcaacgccgcgaatgagatcgcggttgaggcgttcctgcgccggcggatc
ggctttctcgacatcacggcggtggtcgaacgggtcatgcagcgcctcggcgcgcccccg
atcggcgatctcgcggccgtgcttgccctcgatgccgaagcgcgcgccatggcggaggcg
gaattgcgcgcgaagtccgacccgcgcgcggcgtga

DBGET integrated database retrieval system