KEGG   Acidiphilium multivorum: ACMV_29670Help
Entry
ACMV_29670        CDS       T01446                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
amv  Acidiphilium multivorum
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ACMV_29670 (adh)
Enzymes [BR:amv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     ACMV_29670 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3238101..3239144
Genome map
AA seq 347 aa AA seqDB search
MKAAVLHGYDEKLTAPDFVTYEDVPEPQIRNPTDVIVRIGGAGVCRTDLHIIEGVWRSKV
DLKFPHIMGHENAGWIEEVGSAVTHLKKGDPVICHPLITSGHCLACRRGDDMHAEESEFP
GINCNGGYAELLRTGARSIIKLPKSLAPKDVAPHTDAGLTAYRAAKKASRHLLPGQFAVV
IGAGGLGHIGIQVLRAMCAARIIIVDRADMALQLAQECGADFAVKADGSELDEVMRLTGG
KGAEAVIDFVGEGDAVAKGLAMTRDGGYYYIVGYGGKIDIPTIDMITSEKTIVGNLVGTY
PELIELMALADQGKVTLATREYRLDEANAALHDLHHGKVRGRAVLIP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgccgtgctgcacggatacgacgaaaagctcaccgcacccgacttcgtcacc
tacgaggacgtgcccgaaccgcagatccgcaacccgaccgacgtcatcgtccgcatcggc
ggcgccggcgtctgccggaccgacctgcacatcatcgagggcgtctggcgctcgaaggtc
gatctcaagttcccgcacatcatgggccacgagaacgccggctggatcgaggaggtcggt
tccgccgtcacccacctgaagaagggcgacccggtgatctgccatccgctgatcacctcc
ggccactgcctcgcctgccgccgcggcgacgacatgcacgccgaggaaagcgaattcccc
ggcatcaactgcaatggcggctatgccgagctgctgcgcaccggcgcgcgctcgatcatc
aagctgccgaaatcgctcgcgccgaaggacgtcgccccgcataccgatgccgggctcacc
gcctaccgcgccgcgaagaaggcctcgcgccacctgctgcccggccagttcgcggtggtg
atcggcgccggcggcctcggccatatcggcatccaggtgctgcgcgcgatgtgcgccgcc
cggatcatcatcgtcgaccgcgccgacatggcgctgcagctcgcccaggaatgcggcgcc
gatttcgcggtgaaggcggacggctccgagctcgacgaggtgatgcgcctgaccggcggc
aagggcgccgaggcggtgatcgacttcgtcggcgagggcgacgccgtggcgaaaggcctc
gcgatgacgcgcgacggcggctactattacatcgtcggctacggcgggaagatcgacatt
cccaccatcgacatgatcacctcggaaaagaccatcgtcggcaatctcgtcggcacctat
cccgagctgatcgagctgatggcgctggccgaccagggcaaggtcaccctcgccacccgc
gaataccggctggacgaggccaatgccgccctgcacgacctgcatcacggcaaggtccgc
ggccgcgccgtgctgattccctga

DBGET integrated database retrieval system