KEGG   Acidiphilium multivorum: ACMV_29860Help
Entry
ACMV_29860        CDS       T01446                                 

Gene name
folE
Definition
GTP cyclohydrolase (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
amv  Acidiphilium multivorum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:amv00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3261629..3262267)
Genome map
AA seq 212 aa AA seqDB search
MDIRTPPDQLDTTLEDGRPSREDAEAAIRTLIRWAGDDADREGVRDTPARVARAYEDFFR
GYGEDPEAILSRTFEETEGYDEMVLLRDIRVESHCEHHMVPIIGVAHVAYLPNRRVVGIS
KLARVVDAYARRLQIQEKLTAQIANTINEVLQPRGVAVVIEAGHECMSTRGVHKPGVSMV
TSRMLGAFRDDPSTRREFLAMIQGRRCTGFET
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtggacattcgcacgccgccggaccagctcgacaccaccctggaggacggccgccccagc
cgcgaggacgcggaggcggcgatccgcacgctgatccgctgggccggggacgacgccgac
cgcgagggggtgcgggacacgccggcccgcgtcgcccgcgcctacgaggatttcttccgc
ggctatggcgaggacccggaggccattctctcccgcaccttcgaggaaaccgagggctat
gacgagatggtgctgctgcgcgacatccgcgtggaatcgcattgcgagcaccacatggtg
ccgatcatcggggtcgcccatgtcgcctacctgccgaaccggcgggtggtggggatcagc
aagctcgcccgcgtggtggacgcctatgcgcggcggctgcagatccaggagaagctgacg
gcgcagatcgccaacacgatcaacgaggtgctgcagccgcgcggcgtcgccgtggtgatc
gaggcggggcacgaatgcatgtcgacccgcggggtgcacaagccgggcgtgtcgatggtg
accagccggatgctcggcgcgttccgcgacgacccctcgacgcggcgggagttcctcgcg
atgatccagggacggcgctgcaccggcttcgagacctga

DBGET integrated database retrieval system