KEGG   Acidiphilium multivorum: ACMV_29860Help
Entry
ACMV_29860        CDS       T01446                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
amv  Acidiphilium multivorum
Pathway
amv00790  Folate biosynthesis
amv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ACMV_29860 (folE)
Enzymes [BR:amv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ACMV_29860 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: BAJ82333
NITE: ACMV_29860
UniProt: F0J4Y6
Position
complement(3261629..3262267)
Genome map
AA seq 212 aa AA seqDB search
MDIRTPPDQLDTTLEDGRPSREDAEAAIRTLIRWAGDDADREGVRDTPARVARAYEDFFR
GYGEDPEAILSRTFEETEGYDEMVLLRDIRVESHCEHHMVPIIGVAHVAYLPNRRVVGIS
KLARVVDAYARRLQIQEKLTAQIANTINEVLQPRGVAVVIEAGHECMSTRGVHKPGVSMV
TSRMLGAFRDDPSTRREFLAMIQGRRCTGFET
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtggacattcgcacgccgccggaccagctcgacaccaccctggaggacggccgccccagc
cgcgaggacgcggaggcggcgatccgcacgctgatccgctgggccggggacgacgccgac
cgcgagggggtgcgggacacgccggcccgcgtcgcccgcgcctacgaggatttcttccgc
ggctatggcgaggacccggaggccattctctcccgcaccttcgaggaaaccgagggctat
gacgagatggtgctgctgcgcgacatccgcgtggaatcgcattgcgagcaccacatggtg
ccgatcatcggggtcgcccatgtcgcctacctgccgaaccggcgggtggtggggatcagc
aagctcgcccgcgtggtggacgcctatgcgcggcggctgcagatccaggagaagctgacg
gcgcagatcgccaacacgatcaacgaggtgctgcagccgcgcggcgtcgccgtggtgatc
gaggcggggcacgaatgcatgtcgacccgcggggtgcacaagccgggcgtgtcgatggtg
accagccggatgctcggcgcgttccgcgacgacccctcgacgcggcgggagttcctcgcg
atgatccagggacggcgctgcaccggcttcgagacctga

DBGET integrated database retrieval system