KEGG   Acidiphilium multivorum: ACMV_30220Help
Entry
ACMV_30220        CDS       T01446                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
amv  Acidiphilium multivorum
Pathway
amv00340  Histidine metabolism
amv01100  Metabolic pathways
amv01110  Biosynthesis of secondary metabolites
amv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    ACMV_30220 (hisD)
Enzymes [BR:amv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     ACMV_30220 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: BAJ82369
NITE: ACMV_30220
UniProt: F0J522
Position
complement(3297209..3298519)
Genome map
AA seq 436 aa AA seqDB search
MIRRLHTAEPGFAAALAALASDRASATDVAAPVAAIIARVRAEGDAALIDLTRRYDRFPI
TPETLRVSAAEIDAACARVGAEQLEAIDLAATRIEAFHRAQLPRDIGFTDAAGARLGLRW
GPLDAVGLYVPGGKASYPSSVLMNAIPARVAGVGRIAMCVPTPDGQMNDLVLAAAWRAGV
AEIYRVGGAQAVAALAYGTEAIAPVDRIVGPGNAFVAEAKRQVFGQVGIDSIAGPSEVLI
IADAGQDPWRVALDMIAQAEHDEAAQSLLVTDDAALAEAVAAELARALETLPRASIAAAS
LAAHGAIIIARDLDEAAEIANRVAPEHLQVMTADPDAVFARIRHAGAAFLGADAPTAIGD
YVAGPNHVLPTGGTARFSSGLSVFDFLKRTTFVALDPAAMASIGPAAATLAVAESLDGHA
RSIRARLTRNRAENLT
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgatccgccgtctccacaccgccgaaccgggcttcgccgccgccctcgccgccctggcc
agcgaccgcgccagcgccaccgacgtcgccgccccggtcgccgcgatcatcgcccgggtg
cgcgccgagggcgacgccgcgctgatcgacctcacccgccgctacgaccgctttcccatc
acgcccgaaaccctgcgggtgagtgccgccgagatcgacgccgcctgcgcccgcgtcggc
gccgaacagcttgaggcgatcgacctcgccgcgacccggatcgaggcgttccaccgcgcc
cagctgccgcgggatatcggcttcaccgacgccgccggcgcgcggctcggcctgcgctgg
gggccgctcgacgccgtcgggctctacgtgccggggggcaaggcgtcctacccctcctcg
gtgctgatgaacgcgattcccgcccgtgtcgccggcgtcgggcggatcgccatgtgcgtg
ccgacgccggacgggcagatgaacgacctcgtcctcgccgccgcgtggcgcgccggggtg
gcggagatctaccgcgtcggcggcgcgcaggccgtcgccgccctcgcctatggcaccgaa
gccatcgccccggtcgaccgcatcgtcgggccgggcaacgccttcgtcgccgaggcgaag
cggcaggtgttcgggcaggtcggcatcgattccatcgccggcccctcggaagtgctgatc
atcgccgatgccgggcaggacccgtggcgcgtcgccctcgacatgatcgcccaggccgag
catgacgaggcggcgcagtcgctcctcgtcaccgacgatgcggcgctggccgaggccgtc
gccgccgaactcgcccgcgcgctggaaaccctgccccgcgcctcgatcgccgccgcctcg
ctcgccgcccatggcgcgatcatcatcgcccgcgatctcgacgaggccgccgagatcgcc
aaccgcgtcgccccggagcatctccaggtgatgaccgccgatccggacgcggtcttcgcc
cgcatccgccatgccggcgccgcctttctcggcgccgatgccccgaccgcgatcggcgac
tacgtcgccgggcccaaccacgtgctgccgaccggcggcacggcgcggttctcctccggc
ctgtcggtgttcgacttcctcaagcgcaccaccttcgtcgccctcgatccggcggcgatg
gcgtccatcggacccgccgcggcgacgctggcggtggccgagagcctcgacggccacgcc
cgttccatccgcgcaaggctgacccgcaaccgggcggaaaacttgacctga

DBGET integrated database retrieval system