KEGG   Acidiphilium multivorum: ACMV_31000Help
Entry
ACMV_31000        CDS       T01446                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Organism
amv  Acidiphilium multivorum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3373987..3374901
Genome map
AA seq 304 aa AA seqDB search
MTQFQGADAPTFATFPTFLGLDRRARDAAHVVAGIPLDVGVTNRAGTRSGPAAIRVASRM
LAGNHHPHYRVMVDDMDLADAGDFAIALGDLPGSLALIEAQAAQIGHLVALGGEHGITLP
LLRALAKARGGPVGLVHFDAHADTWAENFGQVYSHGSVFYHALNEGLVDPRRMIQIGIRS
PLLNEAHDWTLAQGVTILSAQDVHEQGVDRVAERIRAVAGTGATYLSFDIDCLDPAFAPG
TGTPEIGGLASWQAQALLRRLGGIDFVGMDLVEVAPAYDVSEITALAGATMVWEYLALLA
SQGR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgacacagtttcagggcgccgacgcgccgactttcgcgacatttcccacctttctcggg
ctcgatcgccgcgcgcgcgacgcggcccatgtggtggccggcattccgctcgatgtcggc
gtgaccaaccgcgcgggcacgcggtccggcccggcggcgatccgcgtcgcctcgcgcatg
ctggcgggcaaccaccatccgcactaccgcgtcatggtcgatgacatggaccttgccgat
gccggggatttcgccatcgccctcggcgatctgccgggcagcctcgcgctgatcgaggcg
caggcggcgcagatcggccatctggtggcgctgggcggcgagcacggcatcaccctgccg
ttgctgcgcgcgctggcgaaggcgcgcggcgggccggtcgggctcgtgcatttcgatgcc
catgccgacacctgggccgagaatttcggccaggtctacagccatggctcggtgttctat
cacgcgctgaacgaggggctggtcgatccgcgccggatgatccagatcggcattcgctcg
ccgctgctcaacgaggcgcatgactggacgctggcgcagggggtgacgatcctctcggcg
caggacgtgcatgagcagggggtggaccgcgtcgccgaacggatccgcgcggtggcgggg
acgggggcgacctatctcagcttcgacatcgactgtctcgatcccgccttcgcgccgggc
accggcacgccggaaatcggcgggctggcatcgtggcaggcgcaggcgctgctgcgccgg
ctcggcgggatcgatttcgtgggcatggatctcgtcgaggtcgcgccggcctatgacgtg
agcgagatcaccgccctggccggggcgacgatggtgtgggagtatctcgccctgctcgcc
tcgcaggggcgctga

DBGET integrated database retrieval system