KEGG   Acidiphilium multivorum: ACMV_31650Help
Entry
ACMV_31650        CDS       T01446                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
amv  Acidiphilium multivorum
Brite
Enzymes [BR:amv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     ACMV_31650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3447099..3448190)
Genome map
AA seq 363 aa AA seqDB search
MIALYTALITGAIMAGLQAASAAPPGGEFPSKVPVPADNPMTPRKIHLGKQLYFDPRLSL
SGDVSCDTCHNVAGNGSDGLPLSFGVLGRVDRPRHAPTVFNSAFNTVQFWDGRAKSLEDQ
AKGPLLNPIEMGMPSSGAIVKRLAGIPGYRREFARVFGGKTPITFEHVVQAIATYERTLV
TPDSPYDRYLKGDKNALDKSAKQGMHEVSDLGCASCHAGAMFDNPGLPMGTGWFRKFPMI
PTNPTCATYVREYHLADDPGRFDVTHKQSDEHVFKVPSLRNVAVLAPYFQNGSVGSLRTA
VRVMAACQLGKTLTGLQTTNIVAFLNSLTGKFPVETMPHLPETPDSTSMMQVAKLQQNQR
QLN
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgctttacaccgctctgatcaccggcgcgattatggcgggactgcaagcggcc
tcggccgctccccccggcggcgagtttccatcgaaggtgccggttcccgccgacaacccg
atgaccccccggaagatccatcttggcaagcagttgtatttcgatccgcggctgtcattg
tcgggcgacgtgtcctgcgacacctgccacaacgtcgcgggaaatggcagcgatggactg
ccgctctccttcggtgttctgggccgcgtcgaccggccaagacacgcgccgaccgtgttc
aattccgcgttcaatacggtccagttctgggacggacgcgcaaagagccttgaagatcag
gcgaaggggccattgctcaatccgatcgagatgggcatgccgagttccggagccatcgtg
aagcgcctggctgggattcccggttacaggcgggaatttgcccgtgttttcggcggcaag
acgccgatcaccttcgaacacgtcgttcaggcgatcgccacatacgaacggaccctggtg
acgcccgacagcccatacgatcggtatctgaagggcgacaagaacgcgctcgacaagtcg
gcgaagcagggaatgcacgaggtctccgatctcggctgtgcgagctgccacgccggcgcg
atgttcgataatccgggcctgcccatgggaaccggttggttcaggaaattccccatgatc
ccgacaaacccgacctgcgccacctatgtgcgggagtaccatctcgccgacgatcccgga
cggtttgacgtcacgcacaagcaaagcgacgagcacgtcttcaaggttccgagcctgcgc
aacgtcgccgtccttgcgccatatttccagaacgggtccgtggggtcgctgcgaaccgcc
gttcgggtgatggccgcatgtcagttgggcaagacgctgaccgggctgcagacgacgaac
atcgtcgcgttcctaaacagcctgaccggaaagtttccggtcgagaccatgccacacctg
ccggaaacacccgacagcacatcaatgatgcaggttgccaagctccagcaaaatcagcgc
cagctcaactga

DBGET integrated database retrieval system