KEGG   Acidiphilium multivorum: ACMV_32440Help
Entry
ACMV_32440        CDS       T01446                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
amv  Acidiphilium multivorum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:amv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ACMV_32440 (ruvA)
Enzymes [BR:amv01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ACMV_32440 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(3526134..3526748)
Genome map
AA seq 204 aa AA seqDB search
MIGRLCGTAEQIEDGRCLIDVSGVGYVVFCSARSLAALPAPPARATLLVETQVREDAITL
FGFIDAAERDWFRLLTTIQGVGAKVALNLLSALPPDQLASAIAASDRGAITRAPGVGPKL
AARLISELRERIAAMPTGSAFIPTGTAPPVAPPQGKLADALSALVNLGYRRAEAEAALSA
VQAEAGEDAALDELIRGGLRRLAR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcgggcggctctgcggcacggccgagcagatcgaggacgggcgctgcctgatcgat
gtgagcggcgtcggctacgtggtgttctgctccgcgcgcagcctggccgccttgccggcg
ccgccggcgcgcgcgacgctgctcgtcgaaacccaggtccgcgaggatgcgatcaccctg
ttcggcttcatcgatgccgccgagcgcgactggttccgcctgctcaccaccattcagggc
gtgggcgcgaaagtggcgctcaacctgctttcggcgctgccgccggaccagctcgccagc
gccatcgccgcgagcgaccggggggcgatcacccgcgcgcccggcgtcggccccaagctt
gccgcaaggctgatttccgagctgcgcgagcggattgccgcgatgccgaccggctcggcc
ttcatcccgaccggaacggccccgcccgtcgctccgccgcaggggaagctggccgacgcg
ctttcggccctggtcaatctcggctaccgccgtgccgaagcagaggcggccctttccgcg
gtgcaggcggaggccggcgaggacgcggcgctggatgagctgatccgcggcgggctgcgg
cggctcgcccgatga

DBGET integrated database retrieval system