KEGG   Acidiphilium multivorum: ACMV_32750Help
Entry
ACMV_32750        CDS       T01446                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
amv  Acidiphilium multivorum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:amv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACMV_32750 (glgB)
Enzymes [BR:amv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     ACMV_32750 (glgB)
Exosome [BR:amv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACMV_32750 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3559665..3561854
Genome map
AA seq 729 aa AA seqDB search
MSGTREAGMPASADETLDALAAGTHSDPFSVLGPCHGPHGTFVRTLQPGASGVTLLCGTG
LELPMTRVHAGGIFESAPVEAASYRLRIDWGGSSQEIDDPYRYGPLLGRDEIRDLAEGRK
LRLAECLGAIPVAIGGVEGVRFAVWAPNARRVSVIGSFNNWDGRRHPMRFRHDAGVWEIF
IPELSAGVLYKYEILQHSGEVQQKSDPVARQVEGPPATASIVAPVPAFRWRDGAWCAARE
ARADRPLSIYEVHAPSWRRHPDGRPLLWRELADTLIPYVRDLGFTHIEFLPLTAHPFGGS
WGYQPLSQFAPLPALGTPEELADFVDRCHAAGLGVILDWVPGHFPTDAHGLVRFDGTALY
EHEDPREGFHQDWNTLIYNLGRTEVRNFLIASAVFWLETFHIDGLRVDAVASMLYRDYSR
QPGEWIPNRHGGRENLEAVAFLRELSAAIAEDVPGAMLIAEESTAWPGVSHPVEQGGLGF
THKWNMGWMHDTLRYVGHDPVHRKFSHHDMTFGLVYAFSERFVLPISHDEVVHGKRSLLG
KMPGDAWQRLANLRLYLAFMWTQPGKKLLFMGQEFGQSAEWNHDAELNWPEAATPEHAAL
RLLLRDLNHLYRDAPSLSCTDFDPGGFRWVVEDDADQSVFAWLRHVGNDPNALLVLCNFT
PVPRERYRVGVPLPGRWREVLNTDAVEYGGSGLGNLGGIDSDDRPAHGFAQSLSLTLPPL
AALILRAES
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcacgagggaggcggggatgccggcatcggctgacgaaacgctggacgcgctt
gccgccggaacccattccgacccgttcagcgtgcttggtccctgccacgggccgcacgga
acgttcgtccggaccctccagcccggcgcgagcggcgtcacgctcctgtgcgggacgggt
ctggaactgccgatgacccgcgtgcatgcgggcggcattttcgaaagcgcgccggtcgag
gccgcgtcctaccggctcaggatcgattggggtggttccagccaggagatcgacgatccc
taccgctacggcccgctgctcggccgcgacgaaatccgcgatctcgccgaagggcggaaa
ctgcggctcgccgaatgcctcggcgccatccccgtcgcgatcgggggcgtcgagggcgtc
cgcttcgcggtctgggcgccgaacgcgcggcgggtgtccgttatcgggtcgttcaacaac
tgggatggccgccggcacccgatgcggttccggcacgatgccggcgtctgggagatcttc
attccggaactttccgccggagttctctacaagtatgaaattctccagcactcgggcgaa
gtccagcagaaatcggaccccgtcgcgcggcaggtcgagggcccgccggcaaccgcctcc
atcgtcgcgccggtcccggcgtttcgctggcgggatggcgcctggtgtgccgcgcgcgaa
gcccgtgctgaccgaccgttatcaatctacgaagtccacgccccctcatggcgccgtcac
ccggatggccgccccttgctctggcgcgaactggccgacacgctgatcccctatgtgcgc
gatctcggctttacccatatcgaattcctgccgctcacggcgcaccctttcggcgggtcg
tgggggtaccagccgctgtcgcaattcgcgccgctccccgccctcggcacgccggaagag
ctggcggacttcgttgatcgctgtcatgcggcaggtctcggagtcattctcgactgggtg
cccggacattttccgaccgatgcccacgggctcgtccggttcgacggaaccgcgctctat
gaacacgaagatcccagagagggattccatcaggactggaatacgctgatctacaatctc
ggccggaccgaagtcaggaatttcctgattgccagcgcggtgttctggctcgagacattt
cacatcgatggactccgcgtcgatgcggtcgcgtcgatgctgtatcgcgactattcgcgc
cagcccggcgagtggatcccgaaccgccatggcgggcgggagaacctcgaagccgtcgcc
ttcctccgggagctttcagccgccatcgctgaagatgttccaggcgccatgctgatcgcc
gaggaatcgacggcgtggccgggggtgagccatccggtcgaacagggcggtctcggcttc
acccacaagtggaacatgggctggatgcacgacacgttgcggtatgtcggacatgatccg
gtgcatcggaaattctcccaccacgacatgacctttggcctcgtttacgcgttttccgag
cgcttcgtgctgccgatctcgcacgacgaggtcgtgcacggaaagcggtcgctgctcggc
aagatgcccggcgacgcctggcagcgtctggccaacctccggctctacctcgcgttcatg
tggacccagcctggcaagaagctgttgttcatggggcaggaattcggccagagtgcggaa
tggaatcacgatgccgaattgaactggccggaggcggcaacgccggaacacgcggccctg
cgcctgctgctgcgcgacctgaatcatctctatcgcgacgccccctcgctgtcgtgcacg
gatttcgatcccggcggctttcgctgggtggtcgaggatgacgcggatcaaagcgtcttt
gcctggctgcggcacgtgggaaatgacccaaacgccctcctggtcctctgcaacttcacg
ccggtgccgcgtgagcgataccgtgtgggcgtgccgctgccggggcgctggcgcgaggtg
ctgaacaccgacgccgtcgagtatggcggcagcggcctcgggaatctcggcgggatcgac
agtgacgatcgtcccgcccacggcttcgcgcagtcgctgtcgctgacattgccgccgctg
gcagcgctgatcctgcgtgcggagagctga

DBGET integrated database retrieval system