KEGG   Acidiphilium multivorum: ACMV_32770Help
Entry
ACMV_32770        CDS       T01446                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
amv  Acidiphilium multivorum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:amv00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
3563962..3565956
Genome map
AA seq 664 aa AA seqDB search
MSGSALHALAERAGLQVVWQDASGVRRTVSPATLRAILGCLGLEATTDAACRDTMRRLDD
EDLAAAPLLAATAGEALTLPALRAPAVIHLEDGRRLDVMPDRDAAGTVSLPGTLPPGYHR
LETASGVRTLAIAPRRAHTVADALAAAGREGKAWGLAVQLYGLRREGDCGNGDFAALADL
AGPAGRLGADALAISPIHALHAAEPDHYSPYAPSSRFALNPAYAPLDCAPLAEAGLIDWR
KALSRREALLRAAFAAGREDPAFRAFRDDAPAGIRHYALFEALVAERVARGEGRDWRGWP
ASWRDPASADVAAAAQRLDDEVSFHLYAQFRARQGLEMAQRSARGAGMAIGLIADLAVGA
DPAGCDAWARPGEMLRGVSVGAPPDAFNRAGQNWGLTTVSPRGLRRSGFAALRDMMASAL
RFTGGVRIDHAMGLARLWLVPDGASPAEGCYLHYPFADMRRIVALESVRHRGIIVAEDLG
TVPPGFRAELAASGISGMAVMWFEREGRRFLPPADWRPNSVAMTTTHDLPTVAGWWRGTD
LGWRERLGIAGESAADRAEDRRHLWSALRQSGCARGPRPQDREPEAVIDAAVAHIGTASS
ALALLPLEDALGLPDQPNLPGTTTEHPNWRRRMPQPASRMLDPPEVTARLSRLARARKTT
PPPR
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgagcggatcggcattgcacgcgctcgccgagcgggcgggcctgcaggtggtctggcag
gacgcgtcgggcgtccggcgcacggtctcgccggccacgcttcgcgcgatcctcggctgc
ctcggcctcgaagcgaccaccgacgcggcgtgccgcgacaccatgcgccggctcgacgac
gaggacctcgcagccgcgcccctgctcgccgcgaccgcgggcgaagcgctgacgcttccg
gcactccgcgctccagcggtcatccatctcgaggacgggcgccggctcgatgtcatgccc
gacagggatgccgccggaacggtctcgctgcccggcaccctgccaccgggctatcaccgt
ctggagacggcctcaggcgtccgcacgctcgccatcgcgccgcggcgcgcccacaccgtg
gccgatgcgctcgccgccgccggacgggagggcaaggcgtggggacttgccgtccagctc
tacggcctgagacgcgagggcgattgcggcaacggcgatttcgccgccctggccgacctt
gccgggccggccggccgcctcggcgccgatgccctggcgatcagccccattcacgccctg
cacgccgccgagcccgatcattacagcccctatgcgccatcgagccgcttcgccctgaac
ccggcctatgcgcccctcgattgcgcgccgctggcggaggccgggctgatcgactggcgc
aaggcgctctcccgccgcgaggcgctgctgcgcgcggcgttcgccgccgggcgcgaggat
ccggcattccgcgccttccgcgacgatgcgccggcgggaatcaggcattacgccttgttc
gaagccctcgtcgccgaacgcgtcgcccgcggcgaggggcgcgactggcgcggctggccc
gcctcgtggcgcgatccggccagcgccgatgtcgccgcggcggcccaacgcctcgacgat
gaggtgtcgttccacctttacgcccagttccgcgcccgccagggcctggagatggcccag
cgctccgcgcgcggcgccggcatggcgatcggcctcatcgccgaccttgcggtcggcgcc
gatcccgccggctgcgatgcctgggcgcggccgggcgagatgctgcgcggagtctcggtc
ggcgcgccgccggatgcgttcaaccgtgcgggacagaactgggggctgaccaccgtctcg
ccgcgcggcctgcgtcggtcgggcttcgccgccctgcgggacatgatggcatcggcgctg
cgcttcaccggcggcgtgcggatcgaccatgcgatgggcctcgcccggctgtggctcgtc
cccgacggcgccagtcccgccgaagggtgctaccttcactatccgttcgcggacatgcgc
cggatcgtggcgctggaatcggtccgccaccgcggcatcatcgtcgccgaggatctcggc
accgttccgccaggcttccgcgccgagctcgccgcctccggaatttcagggatggcggtg
atgtggttcgaacgcgagggccgccgcttcctgcccccggccgactggcgccccaattcg
gtggcgatgaccacgacgcacgacctgccgaccgtcgccggctggtggcgcggcaccgac
ctcggctggcgggagcgtctcggcatcgccggcgaaagcgccgccgatcgggcggaggac
cgccgtcacctgtggtccgccctccggcaatccggttgcgcccgcgggccgcggccgcag
gatcgggagcccgaagcggtcatcgacgccgcggtggcccatatcggcacggcctcatcc
gcgcttgcgcttcttcccctggaggatgcgctcggactgccggaccagcccaatctcccc
ggcacgaccaccgaacatccgaactggcgacggcgaatgccgcaaccggccagccgcatg
ctcgacccgcccgaagtcaccgccagactgtcacggcttgcccgcgcgcggaaaaccacg
ccgccaccaaggtag

DBGET integrated database retrieval system