KEGG   Acidiphilium multivorum: ACMV_P1_01730Help
Entry
ACMV_P1_01730     CDS       T01446                                 

Definition
putative exodeoxyribonuclease V alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
amv  Acidiphilium multivorum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:amv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ACMV_P1_01730
Enzymes [BR:amv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ACMV_P1_01730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
pACMV1:complement(165394..167589)
Genome map
AA seq 731 aa AA seqDB search
MGNHFIATAPAQTPDREVLAGLVERVTFHNVENGFCVLRVKARGHRDLVTVIGHAATISA
GEWLTASGEWVNDRVHGQQFRARFLRTSAPTTAEGIERYLASGMIRGIGPVYAKKLIRAF
GETVFDVIEAKPERLREVPGIGAVRAGRIVNAWAEQKVVREIMVFLHSHGVSTARAVRIF
KTYGADAVQVMSENPYRLARDIRGIGFRTADAIAEKLGIARDAMIRVRAGIGHALATAMD
DGHCGLPAGELVSLAETLLEVPAPLIGTALDLELAEGTVIADQVAGTDCVFLAGLYRAEQ
GIAERLRIVASGATPWPSIDADKAIGWVESHLGMNLATSQSEAVRLALTAKLLVITGGPG
VGKTTIVRAILRILAAKSVRILLAAPTGRAAKRLAETTGGEAKTIHRLLEVDPASGSFRR
GVDHPLECDLLVIDETSMVDVPLMHALTRAIPDEAALLVVGDVDQLPSVGPGQVLADLIG
SGAVPVVRLTEIFRQASASRIITVAHSVNRGEIPDLGRADPESDFHFVAADEPETAVERI
VELVKTRIPHRFGLDPIRDIQVLCPMARGGVGARSLNITLQAALNGAAEPRVERFGWTYA
PGDKVMQIENDYDREVYNGDIGFIARVDAEAGEVGVGFDGREVVYGLGELDGLVPAYAAT
IHKSQGSEYPAVVIPVLTQHYVMLQRNLLYTGITRGRRLVVLVGSRRAVAIAVRNVSGRR
RWSKLREWLSG
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggggaaccattttattgccactgcccctgctcagacacccgatcgcgaggtcctcgct
ggcctggttgagcgggtgacgttccacaatgtcgagaacggcttttgcgtgttgcgggtg
aaagcccgggggcaccgtgatctcgttacagtcatcgggcatgccgcgacgatcagcgct
ggcgagtggctgacggcgagcggcgagtgggtgaacgaccgggttcatggccagcaattc
cgggcgcggttcctgcggacatcggcgccgaccacggccgaggggatcgagcgctatctg
gcctcgggcatgatccgcggcatcgggccggtgtatgcgaagaaactgatccgagccttc
ggcgagacggtgttcgacgtgatcgaggcaaagcccgagcgcctgcgcgaggtgccgggt
atcggcgcggtgcgggccgggcggatcgtcaatgcctgggccgagcagaaggtggtgcgg
gagatcatggtgttcctgcacagccatggggtgagcacggcccgcgccgtgcggatcttc
aagacctacggcgccgacgcggtgcaggtgatgagcgagaacccgtatcgtctggcgcgg
gacatcagggggatcggtttccggacagcggatgcgatcgcggagaagcttggcatcgcc
agggacgcgatgatccgtgtgcgtgctggcatcggtcatgcgctggcgacggcaatggat
gatggccattgtggcctaccggccggcgaactggtctcgctcgccgaaacgttgctcgag
gtgccggcgccgctgatcgggacggcactcgacctcgaactggcagagggcacggtgatc
gccgatcaggtggcggggactgactgtgtgttcctggccggcttgtatcgggcggagcag
ggtatcgccgaacggctgcggattgttgcctctggtgcaacgccctggccatcgatcgat
gcggacaaggcgatcggctgggtggaaagccatctcggcatgaatctggcgacgagccag
agtgaggcggtgcggctggcgctgaccgcgaagctgttggtgatcaccggcggaccgggt
gtcggcaagaccacgatcgtccgggcgatcctgcggatcctcgctgcgaaatccgtccgc
attctgctcgccgcgccgaccggccgggcagccaagcgccttgccgagacgacggggggc
gaggcgaagacgatccaccgcctgctcgaggtagatcctgcgagcggtagtttccgccgc
ggcgtcgaccatcctctggaatgcgaccttctggtgatcgacgagacctcgatggtggac
gtgccgttgatgcatgcgctgaccagggcgatccccgacgaggcagcgctgctggtggtg
ggagatgtcgaccagcttccctcggtgggaccggggcaggtgctcgccgatctgatcggg
tctggcgcggtaccggtggtgcggctgacggagatcttccgccaggcatcggcgagccgg
atcatcaccgtggcgcatagcgtcaatcgcggggagatccccgatctcggccgcgctgat
cccgagagcgatttccatttcgtggcggccgacgagccggagacggcggtcgagcgcatc
gtggagctggtgaagacgcggattccgcaccggtttggactggatccgatccgcgacatc
caggtgctctgtccgatggcccggggtggggtcggcgcgcggtcactcaacatcaccctg
caggcggcgctgaacggcgcggcggaaccgcgggtcgagcgattcggctggacctatgct
cccggcgacaaggtcatgcagatcgagaacgactacgaccgggaggtctacaacggcgat
atcggctttattgcccgggtcgatgcggaggccggggaggttggcgtcggcttcgatgga
cgggaggtggtctacggtctcggcgagctggacgggcttgtgccggcctatgcggcgacg
atccacaagtcccagggctcggaataccctgccgtcgtcattccggtgctgacccagcac
tacgtgatgctgcagcggaacctgctctacaccggcatcacgcgcggccggcggctagtc
gttctggtcggcagtcggcgtgctgtcgccatcgccgtgcggaatgtctcggggcggcgc
cgatggtcgaagctcagagagtggctgtcaggatga

DBGET integrated database retrieval system