KEGG   Acidiphilium multivorum: ACMV_P4_00240Help
Entry
ACMV_P4_00240     CDS       T01446                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
amv  Acidiphilium multivorum
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:amv00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:amv00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
pACMV4:20916..21470
Genome map
AA seq 184 aa AA seqDB search
MIETLVLPDVKLITPPRFADSRGWFSETWNQAKLAALGFTETFVQDNHSCSTRPGTIRGL
HCQIAPFAQGKLVRCIRGAIWDVAVDIRHGSPGFGRFAAAELSAANGAQLWIPPGFLHGF
CTLEPDTEVVYKVTAPYDKASERGVIWNDPDLALPWPVPGDGALLSDKDNLLPRLAEAEP
WFTL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaacactcgtactgcccgacgtgaaactcataaccccgccgcgcttcgccgat
tcgcgcggctggttcagcgaaacctggaaccaggcgaagctcgccgccctcggcttcacc
gaaaccttcgtgcaggacaaccactcctgctccacccggcccggcaccatccgcggcctg
cactgccagatcgcccccttcgcccagggcaagctcgtccgctgcatccgcggcgcgatc
tgggacgtcgccgtcgatatccgccacggctcgcccggcttcggccgcttcgccgccgcc
gaactctccgccgccaacggcgcccagctctggattccgcccggcttcctgcacggcttc
tgcacgctcgaacccgataccgaggtcgtctacaaggtcaccgccccttacgacaaagcc
tccgagcgcggcgtcatctggaacgatcccgatctcgccctgccctggcccgttcccggc
gatggcgccctgctctcggacaaggacaatctcctgccccgcctcgccgaggccgaaccc
tggttcacgctctga

DBGET integrated database retrieval system