KEGG   Amycolatopsis mediterranei RB: B737_0859Help
Entry
B737_0859         CDS       T02804                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amz00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    B737_0859 (deoA)
Enzymes [BR:amz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     B737_0859 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
927924..929201
Genome map
AA seq 425 aa AA seqDB search
MSAFAAVDVIRTKRDGGTLSDEQIDWVVDAYTRGDVAEEQMSALAMAIFLRGMTSAEISR
WTHAMIASGERLSLSVSRPTVDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTG
GTLDKLESIPGWRAALSTSEIQSQLEDVGAVVCAATSGLAPADKKLYALRDVTSTVESIP
LIASSIMSKKIAEGASGLVLDVKFGSGAFMKSLDQARSLASALTSIGADHGVPTTALLTD
MNVPLGRAVGNAVEVAESVDVLKGGGPADVVALTVALAREMLALAGLDVDPAAVLASGEA
YEVWCRMIAAQGGDPSAPLPTPSHVHVVTAPSSGVLASLDAYAVGVAAWRLGAGRARKED
PVQAAAGILCLAKPGDAVSEGDPLLELHTDTPDAVPAALSALEGGFTIASSAPEPGPIVV
ETIRS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgttcgcggcggtcgacgtcatccggaccaagcgggacggcggcacgctttcc
gacgagcagatcgactgggtcgtcgacgcctacacccggggtgacgtcgccgaagagcag
atgtcggcgctggccatggcgatcttcctgcgcgggatgacctcggccgagatctcccgg
tggacgcacgcgatgatcgcgtcgggggagcggctgtcgctttcggtgtcccggccgacg
gtggacaagcactcgacgggcggggtcggcgacaagatcacgctgccgctggcgccgctg
gtggcggcgtgcggcgcggccgtgccacagctgtccggccgcgggctcggccacaccggc
gggacgctcgacaagctggagtcgattcccggctggcgcgccgcactgtccacttcggag
attcaatcgcagctggaggacgtcggcgcggtggtctgcgcggcgacgtccgggctggcg
ccggcggacaagaagctgtacgcgctgcgggacgtcacgtccactgtggagtcgatcccg
ctgatcgccagctcgatcatgagcaagaagatcgccgaaggcgcgtccgggctggtcctg
gacgtgaagttcgggtcgggcgcgttcatgaagtcgcttgaccaggctcgttcgctggct
tccgcgttgacctcgatcggcgccgatcacggtgtcccgacgacggcgttgctgaccgac
atgaacgtcccgctggggcgggcggtcggcaacgcggtggaggtcgcggagtcggtcgac
gtgctcaaaggcggcggtccggcggacgtggtcgcgctgactgtggccctggcccgggag
atgctggcgctggccggcctcgacgtcgacccggcggcggtgctggcttcgggcgaggcg
tacgaggtctggtgccggatgatcgcggcccagggcggcgacccgtcggcgccgctgccg
acgccctctcacgtccacgtggtcacggcgccttcttcgggggtgctggcttcgctggac
gcgtacgcggtgggcgtcgcggcgtggcggctcggtgcgggccgcgcccgcaaggaggac
ccggtccaggccgcggcgggcatcctgtgcctggccaagccgggggacgcggtctccgag
ggcgacccgctgctggaactccacacggacacgcctgacgcggtcccggccgccctgtcc
gcgctcgagggtgggttcacgatcgcttcgtcggcgcctgaaccgggcccgatcgtcgtg
gagaccatccgtagctag

DBGET integrated database retrieval system