KEGG   Amycolatopsis mediterranei RB: B737_2430Help
Entry
B737_2430         CDS       T02804                                 

Gene name
yvaK
Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
amz  Amycolatopsis mediterranei RB
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2627359..2628126)
Genome map
AA seq 255 aa AA seqDB search
MGVLAGAEPFGHTGSAETGFLLCHGFTGTPASMRAWGDHLAGAGFTVRCPLLPGHGTRWP
DLNRTTWEDWYGAVREALLALLATCKTVFVGGLSMGGTLTLRLAEEFGDRIAGIVLVNPS
VTRLKWDTRLLPVLGRIVPSVPAIANDIKKPGETELAYPRTPVRAAASLAKLWAVVRADL
AKVTQPVLLLHSSVDHVVEPVNSQLVLDGVSSTDVTEVVLENSYHVATQDNDAEVIFTRS
VEFAKAHAAQPEETA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgctcgccggcgcggaaccgttcggccacaccggttcggccgaaaccgggttc
ctgctctgccacgggttcaccggtaccccggcgagcatgcgggcctggggtgaccacctg
gccggggccgggttcacggtgcgctgcccgctgctgccgggccacggcacccgctggccg
gacctcaaccgcacgacgtgggaggactggtacggcgccgtgcgcgaagccctgctcgcg
ctgctggcgacgtgcaagaccgtgttcgtcggcggcctctcgatgggcggcacgctcacg
ctgcgcctggccgaggagttcggcgaccggatcgccgggatcgtcctggtcaacccgtcg
gtgacgcggctgaagtgggacacgcggctgctgccggtgctgggccggatcgtgccgtcg
gtgccggcgatcgcgaacgacatcaagaagccgggcgagacggagctggcctacccgcgg
acgccggtgcgcgcggcggcgagcctcgcgaagctgtgggcggtcgtgcgcgccgacctg
gcgaaggtgacgcagccggtgctgctgctgcactcgtcggtcgaccacgtcgtcgagccg
gtgaactcgcagctggtgctcgacggcgtctcgagcaccgacgtcaccgaggtcgtgctg
gagaacagctaccacgtggcgacgcaggacaacgacgccgaggtgattttcacgcgtagc
gtcgagttcgcgaaggcgcacgctgcccagccggaggagaccgcatga

DBGET integrated database retrieval system