KEGG   Amycolatopsis mediterranei RB: B737_2494Help
Entry
B737_2494         CDS       T02804                                 

Definition
hypothetical protein
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amz00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    B737_2494
Enzymes [BR:amz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     B737_2494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2697091..2698692
Genome map
AA seq 533 aa AA seqDB search
MDALVADVVIVGFGAAGACAALEAADAGADVIVVERFAGGGASAVSGGVVYAGGGTTQQL
DAGVDDSVDAMYAYLRRETGDVVSERTLRRFCEGSREMITWLEGNGVPFEGSLCPYKTSY
PSDQHYLYYSGSEAAGGFRDAAKPAARGHRVKGPGTSGKMLMARLKAAVRARGVRVLTQT
TAQTLIRDDAGRVTGLVVDTLSDAPASVRARHQRFAQYAAKPGIYVPSLRKSLHRRVERF
ERSHGRELRISARRGVVLAAGGFIANREMVREHAPEYRGGLALGTSADDGSGIRMGVEAG
GATGELGRISAWRFVTPPSAFLGGIIVDAAGRRVIDESRYGAAVGEKLIEEHGSKGWLLV
DAPIVAEARRDGRKQSQWFQWLQLRYLLRRGRVVGETVEEVARKAGVDPQGLRASVEAYH
GDRDPVGKPLEFVRRLDNPPYSLIDISVRPNLGYPTPMLTLGGLVVDEDTGAVRSTAGQP
VPGLYAAGRTAVGLCSRSYVSGLSLADCVFSGRRAGINSALAQGVLDKNENVF
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggacgcactagtcgcggacgtggtcatcgtggggttcggggcggccggcgcctgtgcc
gccctcgaagcggccgacgcgggcgccgacgtcatcgtcgtcgagcgcttcgccggggga
ggggccagcgcggtcagcggtggcgtcgtctacgccggcggcgggaccacgcagcagctc
gacgcgggcgtcgacgactccgtcgacgcgatgtacgcctacctgcggcgggaaaccggg
gacgtcgtctccgagcggacgctgcggcggttctgcgagggcagccgcgaaatgatcacc
tggctggagggcaacggcgtgccgttcgaaggcagcctgtgcccgtacaagacgtcgtac
cccagcgaccagcactacctctactactccggcagcgaggcggccggcgggttccgcgac
gcggcgaagccggccgcgcgcggtcaccgcgtcaaggggcccgggacctcggggaagatg
ctgatggcgcggctcaaggcggccgtgcgcgcccgcggcgtccgggtgctgacgcagacg
accgcccagaccctgatccgcgacgacgccggccgcgtcaccggcttggtcgtcgacacc
ctgagcgacgcccccgcgtcggtgcgggcgcggcaccagcgcttcgcgcagtacgcggcg
aagcccgggatctacgtgccgtcgctgcgcaagtcgctgcaccggcgggtcgagcggttc
gagcggtcgcacggccgtgagctgcgcatttccgcccggcgcggggtcgtgctcgccgcc
ggcgggttcatcgcgaaccgcgagatggtccgcgagcacgcgccggagtatcgcggcggg
ctcgcgctcggcacgtccgccgacgacggctcgggcatccggatgggcgtcgaggccggc
ggggcgaccggcgagctgggccggatctccgcgtggcggttcgtcaccccgcccagcgcg
ttcctcggcgggatcatcgtcgacgccgcgggccggcgggtcatcgacgagtcccgctac
ggcgccgcggtcggcgagaagctcatcgaggagcacgggagcaagggctggctgctcgtc
gacgcgccgatcgtggccgaggcgcgccgggacggccgcaagcagagccagtggttccaa
tggcttcagctgcggtacctgctgcgccgcggccgggtcgtgggggagacggtcgaagag
gtggcgcgcaaggccggcgtcgacccgcaggggctgcgcgcgagcgtcgaggcctaccac
ggcgaccgggatccggtgggcaagcccctcgagttcgtgcggcgcctggacaacccgccg
tattcgctcatcgacatctcggtgcggccgaacctcgggtacccgacgccgatgctgacc
ctcggcggcctggtcgtcgacgaggacaccggcgcggtgcggagcacggcggggcagccc
gtcccggggctgtacgccgccggccgcaccgccgtgggactctgttccaggtcgtacgtg
agcggtctctcgctggccgactgcgttttttccggccgcagggcagggatcaacagtgcc
ctggcgcagggcgttctcgacaaaaacgagaacgtgttctag

DBGET integrated database retrieval system