KEGG   Amycolatopsis mediterranei RB: B737_3442Help
Entry
B737_3442         CDS       T02804                                 

Definition
monoamine oxidase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:amz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B737_3442
   00330 Arginine and proline metabolism
    B737_3442
   00340 Histidine metabolism
    B737_3442
   00350 Tyrosine metabolism
    B737_3442
   00360 Phenylalanine metabolism
    B737_3442
   00380 Tryptophan metabolism
    B737_3442
Enzymes [BR:amz01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     B737_3442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3777787..3779151)
Genome map
AA seq 454 aa AA seqDB search
MRRTDVVVVGAGLAGLTAARELTAAGRDVVVLEARDRVGGRTVNHDLGDGKVVEAGGQFA
GPTQDHILALAKQVGVETFPAHTQGASVYVNGDRARRYRGDIPPDPLALPDLAIALRRIN
QLAGKIPLEAPWRAPKARAWDSVTFESWIRHTTAGTGALDLVNVLLGSAYGGSAADASLL
YSLWYIAGFGNETTPGTVERGIGVTGGAQESRFAGGSQLISHRIGDELDGRVVLGSPVRT
IEQDDGPVTVKSDVDTWSARHVVVAVPPALAARISWRPLLPPQQDALFSRMTFGALMKCE
AVYPEPFWRADGLNGQAVFRHGSPICSMWDNSPPDGKPGVLMGFLGGPQWHAWAARPPRE
RRAAVLRAFAAAVGKEALRPVEYFEQDWVGEEWTRGGPTSVPGPGVLTELGPWRDRPFGR
VHWAGAEHADHWNGYMDGAVRSGETAARAVLGHE
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcactgacgtcgtcgtggtcggcgcgggcctggccggcctcaccgccgcccgc
gaactgaccgcggccggccgcgacgtcgtcgtcctggaagcccgtgaccgggtcggcggc
cgcaccgtgaaccacgacctcggcgacggcaaagtggtggaggcgggcggccagttcgcc
ggccccacccaggaccacatcctcgcgctggccaagcaggtcggcgtcgaaacgttcccc
gcgcacacccagggggcgtcggtctacgtcaacggcgaccgggcccgccggtaccgcggc
gacatcccgcccgacccgctggccctgcccgacctcgcgatcgccctgcggcggatcaac
cagctggccgggaagatcccgctggaagcgccgtggcgcgctcccaaggcgcgggcgtgg
gacagcgtgacgttcgaaagctggatccggcacaccacggcgggcaccggcgcgctggac
ctggtcaacgtgctgctcggctcggcctacggcggcagcgcggccgacgcgtcgctgctc
tacagcctttggtacatcgccggcttcggcaacgaaaccacccccggcaccgtcgaacgc
ggcatcggtgtcaccggcggagcgcaggaatcccgcttcgccggcggttcccagctgatc
tcgcaccgcatcggtgacgagctcgacggacgcgtggtgctcggctccccggtacggacg
atcgagcaggacgacggcccggtgacggtgaagtccgatgtggacacctggagcgcgcgg
cacgtcgtcgtcgccgtcccgccggcgctggccgcccggatctcctggcgcccgctgctg
ccgccgcagcaggacgcgctgttctcccggatgaccttcggcgcgctgatgaagtgcgag
gcggtgtacccggagccgttctggcgggccgacgggctcaacggccaggccgtgttccgg
cacggctccccgatctgttccatgtgggacaactccccgcccgacggcaaaccgggcgtg
ttgatgggcttcctcggcggcccccagtggcacgcctgggcagcccggccgccccgcgag
cgacgcgccgccgtgctgcgcgccttcgccgccgccgtggggaaagaggcgttgcgcccg
gtggagtacttcgaacaggactgggtcggcgaggagtggacccgcggcggcccgacgtcc
gtgcccgggcccggcgtgctgaccgagctcggtccgtggcgcgaccggccgttcggccgg
gtgcactgggccggcgccgagcacgcggaccactggaacggatacatggacggcgcggtc
cgctcgggcgaaaccgccgcccgcgccgtcctcggccacgagtga

DBGET integrated database retrieval system