KEGG   Amycolatopsis mediterranei RB: B737_4140Help
Entry
B737_4140         CDS       T02804                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:amz00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B737_4140 (rbsK)
Enzymes [BR:amz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     B737_4140 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4609512..4610462)
Genome map
AA seq 316 aa AA seqDB search
MVPMMFSEVVVAGQIARDLVIEVPDAPGADSSAPVKHRQELLGGKGANQAVALGQLGMSV
SLVGVVGRDRTGDALLAQARADRIGTSYVIRRAGTETALLVDVVEDHGRRRYLEHVPEGT
LLTEDDVFAAAAPISAAASLIVQLQQPAPVALLAARLAHTAGTRVVLDGAPQDDALTDGL
LALADVVRADGHEAELLTGQPVDDVAAAARAAADLRRRGPSLVVLEVSGQGNLFAGPEGT
WFVPDVQTDVVDPTGAGDALVATLTAALTRRRPLETAASLAVAAAAATTGHAGGRPHLSR
AELDRLQPRALETVRA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtggtcccgatgatgttcagcgaagtcgtcgtcgccgggcagatcgcccgcgacctggtg
atcgaagtcccggacgcgcccggcgcggactcgtcggcgcccgtgaagcaccggcaggag
ctgctcggcgggaagggcgcgaaccaggccgtggcgctgggccagctcgggatgtcggtg
tcgctggtcggcgtcgtcggccgcgaccgcaccggggacgcgctgctcgcgcaggcccgg
gccgaccggatcggcacctcttacgtgatccgccgggcgggcaccgagacggccctgctc
gtcgacgtcgtcgaggaccacggccggcgccgctacctcgagcacgtcccggaggggacg
ctgctcaccgaggacgacgtcttcgccgcggccgcccccatctcggccgccgcttccctc
atcgtgcagctgcagcagcccgcgccggtggccctgctggcggcccggctggcgcacacg
gcgggcacccgggtcgtgctggacggcgcaccgcaggacgacgcgctgacggacggcctg
ctcgccctcgccgacgtcgtgcgcgccgacggccacgaagccgagctcctcaccgggcag
ccggtcgacgacgtcgccgcggccgcgcgcgccgccgcggatctccggcgccgggggccg
tccctggtcgtgctcgaagtctccgggcagggcaacctgttcgccgggccggaaggcacc
tggttcgtgccggacgtccagaccgacgtcgtcgaccccaccggcgccggtgacgcgctc
gtcgccaccctgaccgcggcgctgacccgccgccgtccgctggagacggcggcgagcctg
gccgtcgcggccgccgcggcgacgaccgggcacgcgggcgggcgcccgcacctgtcccgc
gcggaactcgaccggctgcagccgcgggcgctggaaaccgtccgggcctga

DBGET integrated database retrieval system