KEGG   Amycolatopsis mediterranei RB: B737_4169Help
Entry
B737_4169         CDS       T02804                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:amz00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    B737_4169 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B737_4169 (mhpF)
   00650 Butanoate metabolism
    B737_4169 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    B737_4169 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B737_4169 (mhpF)
   00622 Xylene degradation
    B737_4169 (mhpF)
   00621 Dioxin degradation
    B737_4169 (mhpF)
Enzymes [BR:amz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     B737_4169 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4634622..4635521
Genome map
AA seq 299 aa AA seqDB search
MAPVMAAIVGPGNIGTDLLAKLRRSEVIEVGYVVGVVESDGLERARAQGIAASADGVDWL
LRQDPVPQLVFEATSAKAHAANAPRYAEAGIQAIDLTPAHLGPMVCPPVNLGAHLDAPNV
SMITCGGQATIPMVHAVSRVTAVPYAEIVASVASRGAGPGTRANIDEFTRTTSQAVAEIG
GAGRGKAIIILNPVEPPMIMRDTVFCAIGLDADRDAITASIHEMADEVRKYVPGYSLRAD
PQFDDAREEWDGHARVGIFLEVRGNGDYLPEYAGNLDIMTAAAARVGELMARAKQEVPA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggctcccgtgatggcggcgatcgtcggccccggcaacatcggcaccgatttgctggcg
aagctgcgacgcagtgaagtgatcgaagtcggttacgtggtcggcgtggtcgagtcggac
ggtctcgagcgcgcccgcgcgcaggggatcgcggcgtccgcggacggcgtcgactggctg
ctgcgccaggatcccgtgccccagctcgtgttcgaagcgacgtcggcgaaggcgcacgcc
gcgaacgcgccgcggtacgccgaagccggcatccaggcgatcgacctgaccccggcgcac
ctcggcccgatggtgtgcccgccggtgaacctcggcgcgcacctcgacgcgccgaacgtt
tcgatgatcacctgcggcggccaggccacgatccccatggtgcacgccgtttcgcgggtg
accgcggtcccgtacgccgagatcgtcgcctcggtcgcttcgcggggagcgggccccggg
acgcgggcgaacatcgacgagttcacgcgcacgacgtcgcaggcggtggccgagatcggc
ggtgccgggcgcggcaaggcgatcatcatcctcaacccggtcgagccgccgatgatcatg
cgggacacggtgttctgcgcgatcggcctcgacgccgaccgcgacgcgatcaccgcgtcg
atccacgagatggccgacgaagtccgcaagtacgtgccggggtattcgctgcgggcggac
ccgcagttcgacgacgcacgcgaggaatgggacgggcacgcgcgggtcggcatcttcctc
gaggtccgcggcaacggcgactacctgcccgagtacgccgggaacctggacatcatgacc
gccgcggccgcccgcgtgggcgagctgatggcccgcgcgaagcaggaggtgccggcatga

DBGET integrated database retrieval system