KEGG   Amycolatopsis mediterranei RB: B737_4384Help
Entry
B737_4384         CDS       T02804                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:amz00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:amz00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4875512..4876540
Genome map
AA seq 342 aa AA seqDB search
MFKTLLVASVVAGASLAATATTSAAAAANVVVAKDGSGNYTTVQAGINAVSAGGTISVKP
GTYREVITVPSGKTGITMRGTTGNAADVVVDYNNASGTKKPDGSTYGTSGSATATIAANG
FTATALTFRNSFDRKAHPEITDTQAVAVKTTGDRMVFDNVTFLGHQDTLYADTAAVGTVG
RQYYRGCAISGDVDFIFGRATAVFDRATITALDRGSSSNNGFLTAASTRRSNPYGFLIVG
SKVLSSAANASFYLGRPWHPSGDVDAIAQVLIRETSLPAAIKQSPWTDMSGFSWKDARFA
EYRNTGPGAGTGTDRPQLPAAQAGNYTAQKYLAGGDGWNPVH
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagaccctgctcgtcgcgtcggtcgtcgccggggcgtcgctggcggccactgcg
acgacgtcagcggccgcggcggcgaacgtcgtcgtggccaaggacggctcgggcaactac
accaccgtgcaggccgggatcaacgcggtttcggcgggcggcacgatctcggtcaaaccc
gggacctaccgcgaagtgatcaccgtgccctcgggcaagaccgggatcaccatgcgcggg
accaccgggaacgccgccgacgtcgtcgtcgactacaacaacgccagcggaaccaagaag
cccgacggctcgacctacggcacctccggcagcgcgaccgcgacgatcgccgcgaacggc
ttcaccgcgaccgcgctgaccttccgcaactccttcgaccgcaaggcgcacccggagatc
accgacacgcaggcggtcgcggtcaagaccaccggcgaccggatggtcttcgacaacgtc
accttcctcggccaccaggacaccctgtacgccgacaccgcggccgtcggcacggtcggc
cgtcagtactaccgcggctgcgcgatcagcggcgacgtcgacttcatcttcggccgcgcc
accgcggtcttcgaccgggcgacgatcaccgcgctcgaccgcggttcgagcagcaacaac
gggttcctgaccgcggccagcacccggcggtcgaacccgtacggcttcctgatcgtcggc
agcaaggtgctcagctcggccgccaacgcgagcttctacctgggccgcccgtggcacccg
tccggggacgtcgacgcgatcgcccaggtgctgatccgcgagacctcgctgccggcggcg
atcaagcagtcgccgtggacggacatgtccggcttttcgtggaaggacgcccggttcgcc
gagtaccgcaacaccggcccgggtgcggggaccggcaccgaccggccgcagctgcccgcc
gcccaggccggaaactacaccgcccagaagtacctcgcgggcggcgacgggtggaacccc
gtgcactga

DBGET integrated database retrieval system