KEGG   Amycolatopsis mediterranei RB: B737_4460Help
Entry
B737_4460         CDS       T02804                                 

Gene name
xynA
Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
amz  Amycolatopsis mediterranei RB
Brite
Enzymes [BR:amz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     B737_4460 (xynA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4967322..4968275
Genome map
AA seq 317 aa AA seqDB search
MWQAPAASASVPLQYTTNRYVGSAVAAAYLASETDYRAVLTREFDNVTPENEMKWGTVEA
VRGQYDWSGADAIVEYARTHHKTVRGHTLVWHSQLPDWVGALPADELRRVLHDHITTEVK
RYKGKIRAWDVVNEIFNEDGTRRDTVFRQKLGDGFVADVFRWAHAADPAAKLYLNDYNIE
GINPKSDAVYDLVKTLRRQGVPISGVGIQGHLSIQYGFPGQYRENLARFARIGVETAVTE
ADVRIPTPPDAAKLATQASYFGQLWDGCHAVRKCVEFTTWGFTDRHSWVPDVFPGEGAAC
LFDENLRPKPAYFRLNP
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgtggcaggcgcctgcggcatcggcgtcggtgccgctgcaatacaccacgaaccgttac
gtcggcagcgcggtggccgcggcgtacctggcttcggaaaccgattaccgggcggtgctc
acgcgagaattcgacaacgtgacgccggagaacgagatgaagtggggcacggtcgaagcc
gtgcgcggccagtacgactggtccggcgcggacgcgatcgtcgagtacgcgcggacgcac
cacaagaccgtgcgcggccacacgctggtctggcactcccagctcccggactgggtcggc
gcgctgcccgccgacgagctccgccgggtcctgcacgaccacatcaccacggaagtcaag
cggtacaagggaaagatccgcgcctgggacgtcgtcaacgagatcttcaacgaggacggc
acccgtcgcgacacggtcttccggcagaagctcggcgacggcttcgtcgccgacgtcttc
cgctgggcgcacgcggccgacccggcggcgaagctctacctcaacgactacaacatcgaa
gggatcaacccgaagagcgacgcggtgtacgacctggtgaagacgctgcggcggcagggc
gtgccgatcagcggcgtcggcatccagggacacctgtcgatccagtacggcttcccgggt
cagtaccgggagaacctggcgcgcttcgccaggatcggcgtggagaccgcggtcaccgag
gcggacgtccggatcccgaccccgccggacgcggccaagctcgccacccaggcgagctac
ttcggtcagctgtgggacggctgccacgccgtccgcaagtgcgtcgagttcacgacctgg
ggtttcaccgaccggcactcgtgggtcccggacgtcttcccgggtgaaggcgcggcctgc
ctgttcgacgagaacctgcgcccgaagccggcgtacttccgcctcaacccctga

  All links  
No link information was found.   
DBGET integrated database retrieval system