KEGG   Amycolatopsis mediterranei RB: B737_4545Help
Entry
B737_4545         CDS       T02804                                 

Gene name
glsA
Definition
(RefSeq) glutaminase
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amz00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B737_4545 (glsA)
   00220 Arginine biosynthesis
    B737_4545 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    B737_4545 (glsA)
Enzymes [BR:amz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     B737_4545 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5071061..5071966
Genome map
AA seq 301 aa AA seqDB search
MDLAALLDRIADDVAPEVGRGAVADYIPALARVAPGRFGMAVAEVDGAVHGVGDWEHPFS
VQSMSKVFTLALTLSRGDDVWARVGREPSGDPFNSLVQLEHEDGIPRNPFINAGALVVTD
ELARHGDAVDALLAFLRQESGRAGIAVDPEVAASEAGHADRNRALAYFMASYGNMRHPVP
SVLDQYVRQCSIAMSCADVARSALFLARHGVRNDGSRLLGLSAAKRINAVMLTCGTYDAA
GEFAYRVGLPGKSGVGGGVLAIVPGRCAVCVWSPGLDARGNSVAGVAALDRFTTLTGWSI
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtggacctcgcggcgctgctggaccggatagccgacgacgtcgcgcccgaggtcggccgc
ggcgccgtcgctgactacattcccgcgctggccagggtggcgccggggcggttcggcatg
gcggtggccgaagtggacggtgcggtgcacggcgtcggcgactgggagcacccgttctcc
gtgcagagcatgtccaaagtgttcaccctcgcgctgaccctttcccgcggcgacgacgtg
tgggcgcgggtcggccgcgaaccgtcgggtgatccgttcaattcgctggtgcagctcgaa
cacgaggacggcattccgcgcaacccgttcatcaatgcgggcgcgctggtggtgaccgac
gaactcgcccgccacggcgacgcggtggacgcgctgctcgccttcctccggcaggagagc
ggccgtgcggggatcgccgtggatcccgaggtggcggcgtcggaggcggggcacgccgac
cgcaaccgcgccctcgcgtacttcatggcgtcctacggcaacatgcgccacccggtgccg
tcggtgctggaccagtacgtccgccagtgttcgatcgcgatgagctgcgccgacgtcgcc
cggtcggcgttgttcctggcccgccacggcgtccgcaacgacggctcgcggctgctcggg
ctgagcgcggcgaagcggatcaacgcggtgatgctgacgtgcggcacgtacgacgcggcg
ggcgagttcgcctaccgcgtcggcctcccgggcaagagcggcgtgggcggcggcgtcctg
gcgatcgtcccgggccggtgcgcggtctgcgtgtggagccccgggctggacgcgcgcggc
aactccgtggccggtgtggcggccctggaccggttcacgacgctgaccggctggtcgatc
ttctga

DBGET integrated database retrieval system