KEGG   Amycolatopsis mediterranei RB: B737_4908Help
Entry
B737_4908         CDS       T02804                                 

Definition
glutamate dehydrogenase (NAD(P)+)
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amz00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    B737_4908
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B737_4908
   00330 Arginine and proline metabolism
    B737_4908
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    B737_4908
Enzymes [BR:amz01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     B737_4908
Exosome [BR:amz04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   B737_4908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5499790..5500983
Genome map
AA seq 397 aa AA seqDB search
MTPVPPLMRLTWTDPVTGANGYLVVHSLVSGVATGGTRMRAGCTMTEVEDLARGMADKTA
TFNLPVGGAKGGIDFDPKDPRAFDVLKRFCAFLRPWLDAHWVTAEDLGVPQHLIDSVFAE
LGLEQSYHAAIRRSADPARTLRRVQAGLNAPVPGGLLLGDVVGGYGVAQACLGVAAAWEW
TVRETTVAIQGIGTMGGGAAWYLHEAGVKVVAMADAAGTLYDPAGLDVPALLDLRDRFGE
VDRSRLPAGVRSLPRETIVGIDADIFVPAAISYALRPDNESAVQAKVVVEAANAATTPEA
EAALSARGVAVVPDFVANAGAAAWAWWLLLGEVGADPADSFLRLRTEMQAKIALLLAEWN
MDRLPLRRTGLRLAETNRAVRAEAALTPEGEPALLIP
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgtcccgccgctgatgcggctcacgtggaccgatcccgtgaccggtgcgaac
ggctacctggtcgtgcacagcctggtctccggcgtcgccaccggcggcacccggatgcgg
gccggctgcacgatgaccgaggtcgaggacctcgcccggggcatggccgacaagaccgcg
acgttcaacctgccggtcggcggggccaaggggggcatcgacttcgacccgaaggatccg
cgcgcgttcgacgtgctgaagcgcttctgcgcgttcctgcggccgtggctggacgcgcac
tgggtgaccgccgaggacctgggcgtgccgcagcacctgatcgactcggtgttcgccgag
ctggggctggagcagtcgtaccacgcggcgatccgccgttcggccgatccggcgcggacc
ctgcgccgggtgcaagcgggcctcaacgccccggtccccggcgggttgctgctcggcgat
gtcgtcggcggctacggcgtggcgcaggcgtgcctgggcgtcgcggcggcgtgggagtgg
accgtgcgcgaaacgacggtggccatccagggcatcggcaccatgggcggcggcgcggcc
tggtacctgcacgaagcgggggtgaaggtggtcgcgatggccgacgccgcgggcaccctg
tacgaccccgccggcctcgacgtcccggcgctgctcgacctgcgcgaccgcttcggcgaa
gtggaccggtcgcggctgcccgccggcgtccgctcgctgccgcgcgagacgatcgtcggg
atcgacgcggacatcttcgtgccggccgcgatctcctacgcgctgcggccggacaacgag
agcgccgtgcaggccaaggtggtcgtcgaagcggccaacgcggcgacgacgccggaagcg
gaggccgcgttgtcggcccgcggggtcgcggtggtgccggacttcgtcgccaacgcgggc
gcggcggcctgggcgtggtggctgctgctgggcgaggtcggcgcggacccggccgactcg
ttcctgcggctgcgcaccgaaatgcaagcgaagatcgcgctgctgctggcggagtggaac
atggaccggttgccgctgcgccggaccgggctccggctggccgagaccaaccgggccgtg
cgcgccgaagccgcgctcaccccggaaggcgagccggcgctgctcatcccctga

DBGET integrated database retrieval system