KEGG   Amycolatopsis mediterranei RB: B737_5130Help
Entry
B737_5130         CDS       T02804                                 

Definition
glycoside hydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:amz00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5770441..5771970)
Genome map
AA seq 509 aa AA seqDB search
MKRLLSLVVAALVGGAVLTASPAAAAPGTTAAAGTGTGFWHAAGSQLVDATGTPVRMTGI
NWFGAETGNYSPHGLWSRNYKDMLDQMAGLGYNTLRLPYSNQLFDAGSKPVSIDAVQNPD
LQGLSGLQVLDKIVAYAGVKGMRVLLDRHRPDSGAQSPLWYTSAYSESRWISDWTMLAQH
YKGNPTVIGADLHNEPHSIQGGGGACWGCGDTATDWRLAAERAGNAVLAANPDWLIVVEG
VDCVSGTGDPQCGWWGGNLSGARQFPVRLSKPDKLVYSAHEYATSVFAQTWFSDPAFPAN
LPALWDHFFGYLQKQNIAPVLLGEFGSTLADPRDKVWLQELMKYAGSGPSGMSFTYWSWN
PNSGDTGGILNDDWTTVNQTKQAILQPYLIPPVGSGGGTTDPPPAASCAVTYHVDNTWQG
GFIATVTLKNTGSSALKNWALGWTVPSGTQITGGWNATVTQTGQQASAKAPTWAPDLAGG
ATAAIGIQATGASTGSPGGFAVGATACTT
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgactgctctcgctggtggtcgccgcactggtcgggggcgccgttctcacggcg
tccccggccgccgcggccccgggcaccaccgcggcggccggcaccgggaccgggttctgg
cacgccgccggctcccagctggtcgacgcgaccggcacgccggtccggatgaccgggatc
aactggttcggcgccgagaccggcaactactcgccgcacgggctgtggagccgcaattac
aaggacatgctcgaccagatggccgggctcgggtacaacacgctgcggctgccgtactcg
aaccagctgttcgacgccgggtccaagccggtcagcatcgacgccgtgcagaacccggac
ctgcagggcctgtccggcctgcaggtgctcgacaagatcgtcgcctacgccggtgtcaag
ggcatgcgcgtgctgctggaccggcaccggccggactccggcgcgcagtccccgctctgg
tacaccagcgcgtactccgaaagccgctggatctccgactggacgatgctggcccagcac
tacaagggcaacccgacggtgatcggcgcggacctgcacaacgagccgcactcgatccag
ggtggcggcggggcctgctggggctgcggcgacaccgcgaccgactggcggctcgccgcc
gaacgggccggcaacgcggtgctcgcggcgaacccggactggctgatcgtcgtcgaaggc
gtcgactgcgtcagcggcaccggcgacccgcagtgcggctggtggggcggcaacctctcc
ggagcccggcagttcccggtgcgactgtccaaaccggacaaactggtgtactcggcgcac
gagtacgcgacgtcggtgttcgcccagacctggttctccgacccggcgttcccggcgaac
ctgcccgcgctgtgggaccacttcttcggctacctgcagaagcagaacatcgcaccggtg
ctgctcggcgagttcggcagcacgctcgccgacccgcgcgacaaggtctggctgcaggag
ctgatgaagtacgcgggcagcggcccgtccgggatgagcttcacgtactggtcgtggaac
ccgaactcgggggacaccggcggcatcctcaacgacgactggaccacggtcaaccagacc
aagcaggcgatcctgcagccctacctgatcccgccggtgggttcgggcggcggcacgacc
gacccgccgcccgcggcgagctgcgcggtcacctaccacgtcgacaacacctggcaaggc
ggcttcatcgccacggtgacgttgaagaacaccggcagctcggcgctgaagaactgggcg
ctcggctggaccgtgccgtccgggacgcagatcaccggcggctggaacgcgaccgtcacg
cagaccgggcagcaggcgagcgccaaggcgcccacctgggcgcccgacctggccggcggg
gccaccgcggcgatcggcatccaggcaaccggcgcctcgaccggctcgcccggcggcttc
gccgtcggcgcgaccgcctgcaccacctga

DBGET integrated database retrieval system