KEGG   Amycolatopsis mediterranei RB: B737_5799Help
Entry
B737_5799         CDS       T02804                                 

Gene name
xynA
Definition
glycosyl hydrolase/beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
amz  Amycolatopsis mediterranei RB
Brite
Enzymes [BR:amz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     B737_5799 (xynA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6528313..6530547)
Genome map
AA seq 744 aa AA seqDB search
MRRLLTALSAAVLAIAAAIVLVVAAQPASAATLTRVTDFGSNPSNLNMYTYVPDHVAARP
ALLVAVHYCTGSASGVFNGYARDYVTAADQYGYVIVFPEATRSGQCFDVSSPQALTRGGG
SDPVGILSMVGWAKQRYNVDPSRVYVTGFSSGAMMTNVLAAEYPDVFAAGSAFMGVPAGC
FATTDGSSWNSQCSGGQLIKTAQQWGDQARQMSGGRTGPFPRMQLWHGTADDTLRYPNFG
EEIKQWTNLKGVSQTPSSTDSPQSGWTRTRYGATGTQAPVEGISVQGAGHSLPQNGMVQY
AIAFLGLNSGSTTTTPTTPTTTTSSVPPAGSTLGNAAARTGRYFGTAVSASKLSDSVYTG
ILSREFSMITPENELKIDATEPSQNQFSYTNADRIVNQATSQGARMRGHTLAWYSQQPGW
MQGMEGAALRQAILNHITQVASHYRGKIYAWDVVNEAFADGGSGARRDSNLQRTGDDWIE
AAFRAARAADPDAKLCYNDYNTDDWNQAKTQAVYRMVQDFKSRGVPIDCVGFQSHFNSNS
PVPSNYQTTLQNFANLGVDVQITELDVEGSGTAQADNFRTVTQACLAVARCTGMTVWGIR
DTDSWRASATPLLFDGNGQKKAAYTAVLEALNGGAPPDGGTTTPTTPTTPTTPSPGGCSA
AYVKTAEWNVGFNGQVTVSGTDNWVLTVTFHAPQKVIGSWNYTGTWDSTGYVLTARPNGS
GNVIGFTVQHGGNLTAPTVTCASP
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaagactcctcactgccctttccgccgccgtgctggcgatcgccgcggcgatcgtg
ctggtcgtggcggcgcagccggcgtccgcggccacgttgacccgggtcaccgacttcggc
agcaatcccagcaacctcaacatgtacacctacgtcccggaccacgtggcggcccgcccg
gcgctgctggtggccgtccactactgcaccggctcggcgtcgggggtcttcaacggctac
gcccgcgactacgtcaccgcggccgaccagtacgggtacgtcatcgtgttcccggaagcc
acccgcagcgggcagtgcttcgacgtctcctcgccgcaggccctcacccgcggcggcggc
agcgaccccgtcggcatcctgtcgatggtcggctgggccaagcagcgctacaacgtcgac
ccctcccgcgtgtacgtcaccggcttctcctcgggcgcgatgatgacgaacgtgctcgcc
gcggagtacccggacgtgttcgccgccggctcggcgttcatgggtgtgcccgccggctgc
ttcgcgaccaccgacgggtcgagctggaacagccagtgctcgggcggccagctcatcaag
accgcgcagcagtggggcgaccaggcccggcagatgagcggcgggcgcaccggcccgttc
ccgcggatgcagctgtggcacggcacggccgacgacaccctgcgctaccccaacttcggg
gaggagatcaagcagtggacgaacctcaagggcgtgagccagacgccgtcgtcgactgat
tccccgcagtcgggctggacgcgcacccggtacggcgccaccggcacgcaggctccggtc
gagggcatcagcgtccagggtgccgggcactcgctgccgcagaacgggatggtccagtac
gcgatcgcgttcctgggcttgaacagcggttcgaccacgaccacgcccaccacgccgacc
accacgacgtcttcggtgccgcccgccggcagcacgctcggcaacgcggcggcccggacc
gggcgctacttcggcacggcggtctcggcgagcaagctgtcggacagcgtgtacaccggc
atcctgagccgcgagttctccatgatcacgccggagaacgagctgaagatcgacgcgacc
gagccttcgcagaaccagttctcgtacaccaacgcggaccggatcgtgaaccaggcgacc
agccagggcgcccggatgcgcgggcacacgctggcctggtactcgcaacagcccggctgg
atgcagggcatggagggtgcggcgctgcggcaggcgatcctgaaccacatcacccaggtc
gcgtcccactaccgcggcaagatctacgcgtgggacgtggtgaacgaggcgttcgccgac
ggcggttccggtgcccggcgcgactcgaacctgcagcgcacgggcgacgactggatcgag
gcggcgttccgcgcggcgcgggcggccgacccggacgcgaagctgtgttacaacgactac
aacaccgacgactggaaccaggcgaagacccaggccgtgtaccgcatggtccaggacttc
aagtcccgcggcgtgccgatcgactgcgtcggcttccagtcgcacttcaacagcaacagc
ccggtgccgtcgaactaccagacgacgttgcagaacttcgcgaacctcggggtggacgtc
cagatcaccgagctggacgtcgagggctcggggaccgcgcaggcggacaacttccgcacg
gtcacgcaggcgtgcctcgcggtcgcgcgctgcaccgggatgacggtgtggggcatccgt
gacacggactcgtggcgggcgtcggccacgccgttgttgttcgacggcaacgggcagaag
aaggcggcctacacggcggtgctcgaggcgttgaacggcggagcacccccggacggcggc
acgaccactcccaccaccccgaccacccccaccactccgtcacccggtggctgttcggcc
gcttacgtcaagacggcggagtggaacgtcggcttcaacggccaggtgacggtgtcgggg
accgacaactgggtgctcacggtgacgttccacgcgccccagaaggtcatcggcagctgg
aactacacgggaacgtgggacagcacgggctacgtgctgacggcgaggcccaacggaagc
ggcaacgtcatcggcttcacggtccagcacggcggcaacctgactgccccgacggtgacc
tgcgcgagtccatag

DBGET integrated database retrieval system