KEGG   Amycolatopsis mediterranei RB: B737_6604Help
Entry
B737_6604         CDS       T02804                                 

Gene name
proB
Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:amz01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:amz00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7391565..7392674)
Genome map
AA seq 369 aa AA seqDB search
MSGTREAIAAARRLVVKVGSSALTSAGSGLDAARLDALVDAIAERVARETQIVLVSSGAI
GAGLAPLSLGKRPRDLATQQAAASVGQLALAHAYAESFGRYSLTVGQVLLTSDDVVRRSH
YRNAQRTFSRLLALGAVPVVNENDTVATEEIRFGDNDRLAALVAHLIGADALILLSDVDG
LYDGDPRGGATRKLTEVLSESDVDGISVGMSSSGLGTGGMVSKLAAARTAAGAGIPVLLA
AASEASAALTSASPGTAFAPADTRLSARRFWLGYAADTTGKLRLDDGAVTAVVRRRRSLL
AAGITGVDGEFQAGDVVDLVDAKDRPVARGVVAFDATELPDLIGRSTPELPAEQRREVVH
ADDLVPLRR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcacgcgcgaagccatcgctgccgcgcggcggctggtggtcaaggtcggctcg
tcggcgctgaccagcgcgggcagcgggctcgacgccgcccggctggacgcgctggtcgac
gcgatcgccgagcgcgtcgcccgggaaacgcagatcgtgctggtgtcctcgggcgcgatc
ggggccggcctggccccgctctcgctgggcaagcggccgcgtgacctcgccacccagcag
gcggcggcgagcgtcgggcagctggcgctggcgcacgcgtacgccgagtcgttcgggcgg
tactcgctgacggtcgggcaggtgctgctgacctccgacgacgtcgtccgccgctcgcac
taccgcaacgcgcagcggacgttttcgcggctgctggcgctcggcgcggtcccggtcgtc
aacgagaacgacacggtggcgaccgaggaaatccgcttcggcgacaacgaccgcctggcg
gccctggtggcccacctgatcggcgccgacgcgctgatcctgctgtccgatgtggacggc
ctgtacgacggcgacccccgcggcggcgcgacccgcaagctgacggaggtcctgtccgag
tccgatgtggacggaatctcggtcggcatgtccagctccggcctgggcacgggcggcatg
gtctccaagctcgcggccgcccgcaccgcggcgggagcgggcatcccggtgctgttggcg
gcggcttcggaagcctcggcggcgttgacttccgcttccccgggcacagctttcgccccg
gcggacacgcgcctgtcggcccgcaggttctggctgggctacgcggcggacaccacgggc
aagctccgcctcgacgacggcgcggtgacggcggtggtccgccgccgccggtccctcctg
gccgcgggcatcacgggcgtggacggcgaattccaggcgggcgacgtggtcgacctggtg
gacgccaaggaccgcccggtggcccgcggagtggtggccttcgacgcgacggagctcccg
gacctgatcggccgttcaacccccgagctcccggccgaacaacgccgcgaggtcgtccac
gccgacgacctcgtccccctccgccgctga

DBGET integrated database retrieval system