KEGG   Amycolatopsis mediterranei RB: B737_6674Help
Entry
B737_6674         CDS       T02804                                 

Gene name
xylA
Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    B737_6674 (xylA)
   00051 Fructose and mannose metabolism
    B737_6674 (xylA)
Enzymes [BR:amz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     B737_6674 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7479594..7480742
Genome map
AA seq 382 aa AA seqDB search
MSDFAPQPADKFTFGLWTVGWPANDPFGVATRPPLDPVESVHRLAELGAYGVTFHDDDLL
ATEPDRDKAIERFRKALAETGLKVPMATTNLFTHPVFKDGGLTSNDRDIRRYALRKVRRN
LDLAAELGAQTYVVWGGREGAESDAAKDVRAALDRYKEGLDLLADYVVEKGYSLRFALEP
KPNEPRGDILLPTIGHALGFISQLARPEMFGLNPEVGHEQMAGLNFVHGISQALWQGKLF
HIDLNGQHGPKFDQDLIFGHGDLKSAFFLVDLLENAGYDGPRHFDYKPMRTEDAEDVWVS
AAANMRTYLILKEKSAAFRADPEVVEALAASRVPDLSTPTLAPGETFDDVLNDEFDLEAA
AARGYHFTRLNQLALEHLLGVR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacttcgctccccagccggccgacaagttcaccttcggcctctggaccgtgggc
tggcccgcgaacgacccgttcggagtcgcgacgcggccgccgctggacccggtggagagc
gtgcaccggctggcggagctgggcgcctacggcgtgaccttccacgacgacgacctgctg
gccaccgagccggaccgcgacaaggcgatcgagcgcttccgcaaggcgctcgccgaaacc
ggcctcaaggtgccgatggcgacgacgaacctgttcacccacccggtgttcaaggacggc
ggcctgaccagcaacgaccgcgatatccgccggtacgcgctgcggaaggtgcgccgcaac
ctcgacctggcggccgagctgggcgcgcagacgtacgtcgtctggggcggccgcgaaggc
gccgagtccgacgccgcgaaggacgtccgcgcggccctggaccgctacaaggagggcctg
gacctgctcgccgactacgtcgtcgagaagggctactcgctgcggttcgcgctggagccg
aagccgaacgagccgcggggcgacatcctgctgccgacgatcgggcacgcgctgggcttc
atctcgcagctcgcgcggccggagatgttcgggctgaacccggaggtcgggcacgagcag
atggccgggttgaacttcgtgcacggcatctcgcaggcgctgtggcagggcaagctgttc
cacatcgacctcaacggccagcacggcccgaagttcgaccaggacctgatcttcggccac
ggcgacctgaagagcgcgttcttcctggtcgacctgctggagaacgccggctacgacggc
ccgcggcacttcgactacaagccgatgcgcaccgaggacgccgaagacgtctgggtgtcg
gcggcggcgaacatgcggacctacctgatcctcaaggagaagtcggcggcgttccgggcc
gacccggaagtcgtggaggcgctggcggcgtcgcgggtcccggacctttcgacgccgacg
ctggccccgggcgagacgttcgacgacgtcctgaacgacgagttcgacctggaagcggcg
gccgcccgcggctaccacttcacccggctgaaccagctcgccttggagcacctgctcggc
gtgcgctga

DBGET integrated database retrieval system