KEGG   Amycolatopsis mediterranei RB: B737_6725Help
Entry
B737_6725         CDS       T02804                                 

Definition
glutamate dehydrogenase
Orthology
K15371  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:amz00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:amz00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:amz00330]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:amz00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7533535..7538541)
Genome map
AA seq 1668 aa AA seqDB search
MSSTGVSSLPGTGADAEPEFGRRSPASPEQIRDDLIDAAAGLAPEIGELVRLYYRHLPPE
EIVGDEPVNLVGAVRSHLQLAKHRMPGRPAVRLLNPTVAEDGWAREATVVQVVTDDMPYL
VDSIAAEFARDGVQVQRIVHPIVVVTRDLTGELQEVHPEADPAEPPANSAAESWMYIEID
FVTDRNRARELDNRLSSVLGDVREVVEDAEKMGQTACQLASELETAPPQLPADEVAEGAR
LLRWLADGHFTFLGYRRYELIENPASDEHAAPALRAVLASGLGVLRQDSLAARGLTAGPD
TAATALAPTLLVLTQASAPSTVHRPVYPYYVGVKTFDAEGTVTGEHRFLGMFTTTALHEN
VLDIPVVGKRVREVIHRAGFPIESFSGQRMLEILQNWPRADLFSADSDSLYSTTTGAITL
SDRRRLRLFLRRDPYGRFYSCLVYLPRDRYTTRSRLAMQEVLLEELEGTQLEYSARIGET
VLAQVHFVVHTDPARRLEPDTLKIQDRLNDAVRTWDDRMVEAVLDERRERADGGVAVGIV
GEESATEQGQRFAMVFPEGYKEDFTAEEALADLRSLDSLTDEGDLALSFYQPADAGPGER
RFKLYLRGEGVTLSKVLPVLQAMGVEVVDERPYELHREDGGACWIYDFGLHVDQKMLDES
DGEAVAELRGRFQDAFEAAWRGDAEVDGLNGLVLRAGLTWRQAAVLRAYSRYLRQVGSAF
SQDYIQNTLLNHTQVATKLLRLFEARFDPQLSDADREAATDALTSELNAMIDEVTSLDED
RILRRLMAVIRATLRTNYHVTGADGKTRPYLAIKLDPAGVPDLPEPRPKFEIFVYSPRVE
GVHLRFGEVARGGLRWSDRREDFRTEILGLVKAQAVKNAVIVPVGAKGGFVVKRPPAPSG
DASIDRDAQLTEGIACYRMFISGLLDLTDNRIEGKTVPAPGVVRHDADDSYLVVAADKGT
AKFSDIANEVSAQYGFWLGDAFASGGSVGYDHKAMGITAKGAWESVKRHFRELGKNTQTE
DFTVVGIGDMMGDVFGNGMLLSEHIRLVAAFNHMHVFLDPDPDAAASYAERRRLFDLPRS
SWDDYDRSLISEGGGIYPRTAKSIPISPQVRVALGLEEGVTALAPMDLIQAILLAPVELL
WNGGIGTYVKAETESHQAAGDKANDAIRVDGHQLRVKVFGEGGNLGLTQLGRIEFARRGG
PGGAGGKINTDALDNSAGVDCSDHEVNIKILLDHLVQTGKLEREQRNELLEEMTDEVGAL
VLKDNYRQNAVLGVSRAHAAPMLSVHARQVQALVSAGAFDRKLEALPSNSEFRELEKAGK
GLTSPELATLLAHVKLELKDELLASDLPDSKVFAARLPEYFPKPLRERFGSAIGEHPLRR
QIITTLIANEVVDGGGISFVYRLMEEMNATATDAVRAYAVVTQVFDLPALWQEIDALDNV
VHTDVADEMVLETRRLLDRAARWFLTNRPQPLAPLSEIKRFGRVLGKLVPKIGDLLRGRE
AESVEKHVNELIAANVPEGLARRVSLLLHTYGLLDVTEVAELAEQQIGVDATHSPAETAE
LYYALSAHLDIDQMLTEISKLERGNRWHALARLSLRDDVYSSLRAITLDALRHSDPGSSG
DAKIAQWEKTNASRLQRARVALDEITKSGRLDLATLSVAARQIRSTVR
NT seq 5007 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgaccggagtctcgtccctacccggaaccggagccgacgccgaacccgaattc
ggccggcgctccccggccagcccggagcagatcagggacgacctgatcgacgccgccgcc
gggctggcgccggagatcggtgagctcgtccggctctactaccggcacctcccgcccgaa
gagatcgtcggcgacgagccggtcaacctggtcggcgccgtgcggtcgcacctgcagctg
gccaagcaccggatgcccggccgcccggccgtgcggctgctgaacccgaccgtcgccgaa
gacgggtgggcgcgggaagccaccgtggtgcaggtcgtcaccgatgacatgccctacctg
gtcgactcgatcgccgcggagttcgcccgggacggcgtccaggtgcagcggatcgttcac
ccgatcgtggtggtcacccgggacctcaccggtgagctgcaggaggtccaccccgaagcg
gacccggccgagccgcccgcgaactcggccgccgagtcgtggatgtacatcgagatcgac
ttcgtcaccgatcgcaaccgggcccgcgagctcgacaaccggctctccagcgtgctgggc
gacgtccgcgaggtcgtcgaggacgccgagaagatgggccagacggcctgccagctggcg
agcgagctggagacggccccaccgcagctgcccgcggacgaggtcgccgagggcgcccgc
ctgctgcgctggctggccgacggccacttcaccttcctcggctaccgccgctacgagctg
atcgagaacccggcttccgatgagcacgccgcgccggccctgcgcgcggtcctggcctcg
ggcctgggcgtgctgcgccaggacagcctggccgcccgcggcctgaccgccggcccggac
accgccgccaccgccctagcgcccacgttgctggtgctgacccaggcgagcgcgccctcg
accgtgcaccggccggtctacccgtactacgtcggcgtgaagaccttcgacgccgagggc
accgtcaccggcgagcaccgcttcctcggcatgttcaccaccaccgcgctgcacgagaac
gtcctcgacatccccgtcgtcggcaagcgggtccgcgaggtcatccaccgcgccggcttc
ccgatcgagtcgttctccggccagcggatgctcgagatcctgcagaactggccgcgcgcc
gacctgttctccgccgacagcgactcgctgtactcgacgacgaccggcgcgatcaccctc
tccgatcgccgccggctgcggctgttcctgcgccgcgacccgtacggccgcttctactcc
tgcctcgtctacctcccgcgcgaccgctacacgacgcgctcgcggctggcgatgcaggaa
gtcctgctcgaagagctcgaaggcacccagctcgagtacagcgcgcggatcggcgagacc
gtcctggcgcaggtgcacttcgtcgtgcacaccgacccggcgcgccggctcgagccggac
acgctcaagatccaggaccggctgaacgacgccgtgcgcacctgggacgaccggatggtc
gaggcggtgctggacgaacgccgtgagcgcgccgatggcggggtcgcggtcgggatcgtc
ggcgaggaatcggccaccgagcagggccagcgcttcgcgatggtcttccccgagggctac
aaggaggacttcaccgccgaagaggcgctggccgacctccgctcactcgactcgctcacc
gacgaaggcgacctggcgctgtcgttctaccagcccgccgacgccgggccgggcgaacgg
cgcttcaagctctacctgcgcggtgagggcgtgacgctctcgaaggtgctcccggtgctg
caggccatgggcgtcgaggtggttgacgagcggccgtacgagctgcatcgcgaggacggc
ggcgcgtgctggatctacgacttcggcctgcacgtcgaccagaagatgctcgacgagtcc
gacggcgaagccgtcgccgagctgcgcggccgcttccaggacgccttcgaggccgcctgg
cggggtgacgccgaggtcgacggcctcaacggcctcgtcctgcgcgccgggctcacctgg
cgccaggccgccgtgctgcgcgcgtactcgcggtacctgcgccaggtcggcagcgcgttc
tcccaggactacatccagaacacgctgctgaaccacacccaggtcgcgaccaagctcctg
cggctgttcgaggcccggttcgacccgcagctgtccgacgccgaccgcgaggccgcgacc
gacgcgctgacgagcgagctcaacgcgatgatcgacgaggtcaccagcctcgacgaggac
cggatcctgcggcgcctgatggccgtcatccgggccaccctgcggacgaattaccacgtc
accggcgccgacgggaagacgcggccgtacctggccatcaagctcgacccggccggcgtg
cccgacctgcccgagccgcggccgaagttcgagatcttcgtgtactcgccgcgcgtcgag
ggcgtgcacctgcgtttcggcgaggtcgcgcgcggtggcctgcgctggtcggaccggcgc
gaggacttccgcaccgagatcctcggcctggtcaaggcgcaggcggtgaagaacgcggtg
atcgtgcccgtgggcgcgaagggcggcttcgtcgtcaagcggccgccggccccgagcggc
gacgcgagcatcgaccgcgacgcccagctcaccgagggcatcgcctgctaccgcatgttc
atctccggcctgctcgacctgaccgacaaccggatcgagggcaagaccgtgcccgccccg
ggggtcgtccggcacgacgccgacgactcctacctggtcgtcgccgccgacaagggcacc
gcgaagttctccgacatcgccaacgaggtctccgcgcagtacggcttctggctcggcgac
gccttcgcctccggcggctcggtcggctacgaccacaaggccatgggcatcacggcgaag
ggcgcttgggagagcgtcaagcggcacttccgcgagctgggcaaaaacacccagaccgag
gacttcaccgtggtcggcatcggcgacatgatgggggacgtcttcggcaacggcatgctg
ctgtccgagcacatccgcctggtcgcggcgttcaaccacatgcacgtcttcctcgacccg
gatccggacgcggcagcgtcgtacgccgagcgccgccggctgttcgacctgccgcgcagc
tcgtgggacgactacgaccgttcgctgatcagcgaaggcggcgggatctacccgcgcacg
gcgaagtcgatcccgatcagcccgcaggtccgcgtggccctcgggctcgaggagggcgtc
accgcgctggcgccgatggacctgatccaggcgatcctgctggccccggtcgagctgctg
tggaacggcggcatcggcacctacgtcaaggcggagaccgaaagccaccaggcagccggt
gacaaggccaacgacgccatccgcgtcgacggccaccagctgcgcgtcaaggtgttcggc
gaaggcggcaacctcggcctcacgcagctcggccggatcgagttcgcccgccgcggcggc
ccgggcggcgccggcggcaagatcaacaccgacgcactcgacaactcggccggggtcgac
tgctccgaccacgaggtcaacatcaagatcctgctcgaccacctcgtccagaccggcaag
ctggagcgcgaacagcgcaacgagctgctggaggagatgaccgacgaggtcggcgcgctg
gtcctcaaggacaactaccggcagaacgccgtgctcggcgtcagccgggcgcacgccgcg
ccgatgctgtcggtgcacgcgcgccaggtgcaggcgctggtgtcggcgggcgcgttcgac
cgcaagctcgaggcactgccgagcaactcggagttccgcgagctggagaaggcgggcaag
ggcctcacctcgccggagctggcgaccctgctcgcgcacgtcaagctggagctgaaggac
gagctgctggccagcgacctgcccgactcgaaggtgttcgcggcccggctgcccgagtac
ttcccgaagccgttgcgcgagcggttcggctccgcgatcggcgaacacccgctgcgccgc
cagatcatcaccacgctgatcgccaacgaagtggtcgacggcggtggcatctcgttcgtc
taccggctgatggaggagatgaacgcgacggcgacggacgcggtgcgcgcgtacgccgtg
gtgacgcaggtgttcgacctgcccgcgctgtggcaggagatcgacgcgctcgacaacgtc
gtgcacaccgacgtcgccgacgagatggtgctggagacgcggcggctgctcgaccgggcc
gcgcgctggttcctcaccaaccggccgcagccgctggccccgctctcggagatcaagcgc
ttcggccgcgtgctgggcaagctggtgccgaagatcggcgacctgctgcgcggccgcgag
gccgagtcggtggaaaagcacgtgaacgagctgatcgccgcgaacgtgccggaggggctg
gcccgccgggtttcgctgctgctgcacacctacggcctgctcgacgtcaccgaggtggcc
gagctcgccgagcagcagatcggcgtggacgccacgcacagcccggccgagacggcggag
ctgtactacgcgctctcggcgcacctggacatcgaccagatgctcaccgagatcagcaag
ctcgaacgcggcaaccgctggcacgcgctcgcccggctttcgctgcgcgacgacgtctac
agctcgctgcgcgcgatcacgctggatgcgttgcggcacagcgatcccggctcgtccggg
gacgccaagatcgcgcagtgggagaagacgaacgcgtcccggctgcagcgggcgcgcgtc
gcgctcgacgagatcaccaagtccggccggctcgacctggcgacgctttcggtggcggcc
cgccagatccggagcacagtacggtga

DBGET integrated database retrieval system