KEGG   Amycolatopsis mediterranei RB: B737_8106Help
Entry
B737_8106         CDS       T02804                                 

Gene name
desC
Definition
stearoyl-CoA desaturase (delta-9 desaturase)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:amz01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:amz01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9065320..9066285)
Genome map
AA seq 321 aa AA seqDB search
MTATLDRSQPAGEPSAPKGPKPVTEGTRGMGVQLSVYFGVIAPLVALLVAVPFAWGWGLS
WVDVGIFVVFYAISGLGITVSYHRYFTHGSFKAKQWLRVFMAIAGSIALQGPVITWVADH
RRHHAFSDRDGDPHSPWAFGTSPWAIAKGFWHAHMGWLFERDQTNAERFAPDLVKDPAIK
KVDDLFWLWALVSLLLPAILGGLISWSFWGAVTAFFWAGLVRICVLHHVTWSINSICHMI
GDRPFNARDNSANFWPLAIFSFGESWHNLHHADPTSARHGVKRGQIDISARLIWIFEKFG
WVHDVRWPTPQRLARITTEKA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacggccacgctcgaccgttctcagcccgccggagaaccttcggccccgaagggcccc
aaaccagtcaccgagggcacgcgcggcatgggcgtgcagctgtcggtctacttcggcgtg
atcgcgccgctggtggccctcctggtcgccgtgccgttcgcgtggggctggggactgagc
tgggtcgacgtcggcatcttcgtggtgttctacgcgatcagcgggctcggcatcacggtg
tcctaccaccgctacttcacgcacggttcgttcaaggccaagcagtggctgcgcgtgttc
atggccatcgcgggcagcatcgccctgcagggcccggtgatcacctgggtcgccgaccac
cgccgccaccacgcgttctccgaccgcgacggcgacccgcactcgccgtgggcgttcggc
acctcgccgtgggccatcgccaagggcttctggcacgcgcacatgggctggctgttcgag
cgcgaccagaccaacgccgagcgcttcgcgccggacctggtgaaggacccggcgatcaag
aaggtcgacgacctgttctggctgtgggcgctggtcagcctgctgctgccggccatcctc
ggcgggctcatctcctggtcgttctggggcgccgtgacggcgttcttctgggccggcctg
gtccgcatctgcgtgctgcaccacgtgacgtggtcgatcaactcgatctgccacatgatc
ggcgaccgcccgttcaacgcccgggacaactcggccaacttctggccgctggcgatcttc
tcgttcggcgagtcctggcacaacctgcaccacgccgacccgacgtccgcccgccacggt
gtgaagcgcggccagatcgacatctccgcgcggctgatctggatcttcgaaaagttcggc
tgggtgcacgacgtccgctggccgacgccgcagcgcttggcccgtatcaccaccgaaaaa
gcctag

DBGET integrated database retrieval system