KEGG   Amycolatopsis mediterranei RB: B737_8251Help
Entry
B737_8251         CDS       T02804                                 

Gene name
srfJ
Definition
(GenBank) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
amz  Amycolatopsis mediterranei RB
Pathway
amz00511  Other glycan degradation
amz00600  Sphingolipid metabolism
amz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amz00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    B737_8251 (srfJ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    B737_8251 (srfJ)
Enzymes [BR:amz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     B737_8251 (srfJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Ricin_B_lectin RicinB_lectin_2 Glyco_hydro_30C Glyco_hydro_59 Glyco_hydr_30_2
Motif
Other DBs
NCBI-ProteinID: AGT88912
Position
9229321..9231156
Genome map
AA seq 611 aa AA seqDB search
MIGVSAVAAATFAGPARAAGETVNVWLTTTSDAGGRTVTRGLQQQAPITFAAGTGSGGVT
INVNENTTYQQFEGGGASFTDTAAWLMNSSGALSQATRDDTMRKLFDPNTGIGLSFIRNP
LGASDLARYSYTFDDVPAGQTDPNLTHFSIAHDQADVLPLTKQAKQLNPQAKIMASPWSA
PPWMKDNDSYLLGWVESQYYPAYAQYFVKYLQAYRDAGVPIDYVSMQNEPTCCASYPSTN
WNGAGLAYFAKNNLLPALQGAGLSTKVLALDWNWDTYASYGAPTLDDSAIRNHPNFGGVA
WHGYGGDIAQQTTTHNQYPTVNAYSTEHSGGTWISNQQAEDMNNIVDYTRNWSKSVTKWS
LAVDQNMGPHNGGCGTCTGLITVHNGDSRSGQVDYTVEYYTMGHLTKFVKPGAYRIDSND
SSAVRNVAWKNPDGSKALIAYNSGTGNQSVRVNWGNSSFTYTLPGRTSATFTWSGTQGTG
GGTGKTGPITGLGGKCVDVAGANSANGTAVQLYDCNGSGAQQWTVGTDGTLKALGKCLDV
TGQSTTDGAQLQLWDCGGTANQRWAATAAKDLVGAGSDKCVDATGNSSANGTRLQIWTCT
GAANQKWNVPA
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
ttgatcggggtgtccgcggtcgccgcggccaccttcgccgggcccgcgcgggccgcgggc
gagacggtcaacgtctggctcaccacgaccagcgacgccggcggccggacggtcacccgc
gggctccagcagcaggcaccgatcacgttcgccgcgggcaccggcagcggcggcgtgacc
atcaacgtcaacgaaaacaccacctaccagcagttcgaaggcggcggagcgtcctttacg
gacaccgcggcctggctgatgaactccagcggggcgctgtcccaggccacccgcgacgac
accatgcgcaagctgttcgacccgaacaccggcatcggcctgagcttcatccgcaacccg
ctgggcgcgtccgacctggcccgctacagctacaccttcgacgacgtgccggccggccag
accgacccgaacctgacgcacttctccatcgcccacgaccaggccgacgtgctgccgctg
accaagcaggccaagcagctcaacccgcaggccaagatcatggcgtcgccgtggagcgcg
ccgccgtggatgaaggacaacgacagctacctgctcggctgggtcgaatcgcagtactac
ccggcctacgcgcagtacttcgtcaagtacctccaggcctaccgggacgcgggcgtgccg
atcgactacgtctcgatgcagaacgagccgacgtgctgcgcgagctacccgtcgaccaac
tggaacggcgcgggcctggcgtacttcgcgaagaacaacctacttcccgcactgcagggt
gccggtctgtccaccaaggtcctcgcactcgactggaactgggacacctacgcgtcctac
ggcgcgccgaccctggacgactcggcgatccggaaccacccgaacttcgggggtgtggcg
tggcacggctacggcggtgacatcgcccagcagacgaccacgcacaaccagtacccgact
gtcaacgcctactccaccgagcactccggcggcacctggatctcgaaccagcaggccgaa
gacatgaacaacatcgtggactacacccggaactggtcgaagagcgtgaccaagtggagc
ctcgccgtcgaccagaacatgggcccgcacaacggcggctgcggtacctgcaccgggctg
atcaccgtccacaacggagactcgcgcagcgggcaggtcgactacaccgtcgagtactac
acgatgggccacctgacgaagttcgtgaagccgggcgcgtaccggatcgactcgaacgac
agctcggccgtccggaacgtcgcctggaagaacccggacggctcgaaggcgctgatcgcg
tacaactccggcacgggcaaccagagcgtgcgggtgaactggggcaactcgtcgttcacc
tacaccctgcccggccgcacgtcggcgacgttcacctggagcggcacccagggcaccggc
ggcggcaccggcaagaccggcccgatcaccggcctcggcggcaagtgcgtcgacgtcgcc
ggcgcgaacagcgccaacggcaccgccgtccagctctacgactgcaacggctccggcgcc
cagcagtggacggtcggcaccgacggaaccctgaaggcgctcggcaagtgcctcgacgtc
accgggcagtccacaacggacggtgcccagctgcagctctgggactgcggcggcacggcc
aaccaaaggtgggccgcaaccgcggccaaggacctcgtcggcgccggttcggacaagtgc
gtcgacgccaccggcaactccagcgccaacggcacccggctgcagatctggacctgcacc
ggcgccgccaaccagaagtggaacgtgcccgcatga

DBGET integrated database retrieval system