KEGG   Anabaena sp. PCC7120: all0143Help
Entry
all0143           CDS       T00069                                 

Definition
hypothetical protein
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
ana  Anabaena sp. PCC7120
Pathway
Metabolic pathways
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(148503..149681)
Genome map
AA seq 392 aa AA seqDB search
MTVASALALLLLLIQVPATAILLSRLFKGPRRLPPIQPQQPTPELLGNVSVVVPTLNEAL
RISPLLAGLSRQSYEVREVIVVDSKSQDGTPDLVKVAQQQDPRFRLINDDPLPSNWVGRP
WALHNGFLYSSEDSQWFLGMDADTQPHPGLVASLVKIAQAQEYDLVSLSPQFILQYPGEC
LLQPALLMTLLYRFDPAGVTTDQPERVMANGQCFLCRRSVLAAVGGYSSASSSFCDDVTL
ARHIAAQGFKVGFLDGAKVLKVRMYEGALETWKEWGRSLDLKDASPRAQIWGDLWLLSAV
QGLPLLIVTGYLLINSWQLMLPVKLLLGLNVFLLVIRFAMLLAIAPSYDRQNAKAGWLFW
LSPLADALAVLRIFLSAFRTPREWRGRTYSKE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
ttgacagtagcaagtgccttggcgcttctgttactactcatccaagtgccagcaacagca
attctgctgtctcgtctatttaaggggccaagacggttacccccaattcaacctcaacaa
ccaacaccagaacttttgggcaatgtgagcgttgttgttcccacactgaatgaagctctg
cggatcagtcctctgttagctggtttgagtcgccaaagttacgaagttcgggaagtaatt
gttgtagacagtaagtcccaagatggaactcccgatttagtaaaagttgcacagcagcaa
gacccccgctttcgcctcatcaatgatgatcctttgccctctaattgggtaggaagacct
tgggcattgcataacggctttttgtatagttcggaagatagtcaatggttcttaggcatg
gatgctgatactcagccccatcctggtttagttgctagtttagtgaaaatagcccaggcc
caggaatacgacttagtatccctatcaccccagtttattcttcagtatccgggtgagtgc
ttgttgcaacccgccttgttgatgactcttctttacagatttgaccccgcaggcgttact
acagaccaaccagaaagggtaatggctaacggacaatgctttttatgccgtcgctctgta
ttagctgctgtgggtggctacagtagcgccagtagctctttttgtgacgatgttacgttg
gcacgtcatattgccgcccaagggtttaaggtgggctttttagacggggctaaggtattg
aaagtgagaatgtatgaaggggcgttagaaacttggaaggaatggggacgcagccttgat
ttaaaagatgcctctccccgcgctcaaatttggggagatttatggttactatcggcagta
caaggtttacctttattgattgtaactggttacttgctgattaattcctggcaactaatg
ttgcctgtcaagttgttattgggactgaatgtatttctactggtgattcgctttgctatg
ctattggcgatcgctccttcctacgaccgtcaaaatgctaaagctggctggctgttttgg
ttatcacccttggccgatgctttagcagttctgcgaatcttcttatctgcttttcgcact
cccagggaatggagaggtagaacttatagcaaggaatag

DBGET integrated database retrieval system