KEGG   Nostoc sp. PCC 7120: all0143Help
Entry
all0143           CDS       T00069                                 

Definition
hypothetical protein
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Metabolic pathways
Brite
Enzymes [BR:ana01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     all0143
Glycosyltransferases [BR:ana01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   all0143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(148503..149681)
Genome map
AA seq 392 aa AA seqDB search
MTVASALALLLLLIQVPATAILLSRLFKGPRRLPPIQPQQPTPELLGNVSVVVPTLNEAL
RISPLLAGLSRQSYEVREVIVVDSKSQDGTPDLVKVAQQQDPRFRLINDDPLPSNWVGRP
WALHNGFLYSSEDSQWFLGMDADTQPHPGLVASLVKIAQAQEYDLVSLSPQFILQYPGEC
LLQPALLMTLLYRFDPAGVTTDQPERVMANGQCFLCRRSVLAAVGGYSSASSSFCDDVTL
ARHIAAQGFKVGFLDGAKVLKVRMYEGALETWKEWGRSLDLKDASPRAQIWGDLWLLSAV
QGLPLLIVTGYLLINSWQLMLPVKLLLGLNVFLLVIRFAMLLAIAPSYDRQNAKAGWLFW
LSPLADALAVLRIFLSAFRTPREWRGRTYSKE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
ttgacagtagcaagtgccttggcgcttctgttactactcatccaagtgccagcaacagca
attctgctgtctcgtctatttaaggggccaagacggttacccccaattcaacctcaacaa
ccaacaccagaacttttgggcaatgtgagcgttgttgttcccacactgaatgaagctctg
cggatcagtcctctgttagctggtttgagtcgccaaagttacgaagttcgggaagtaatt
gttgtagacagtaagtcccaagatggaactcccgatttagtaaaagttgcacagcagcaa
gacccccgctttcgcctcatcaatgatgatcctttgccctctaattgggtaggaagacct
tgggcattgcataacggctttttgtatagttcggaagatagtcaatggttcttaggcatg
gatgctgatactcagccccatcctggtttagttgctagtttagtgaaaatagcccaggcc
caggaatacgacttagtatccctatcaccccagtttattcttcagtatccgggtgagtgc
ttgttgcaacccgccttgttgatgactcttctttacagatttgaccccgcaggcgttact
acagaccaaccagaaagggtaatggctaacggacaatgctttttatgccgtcgctctgta
ttagctgctgtgggtggctacagtagcgccagtagctctttttgtgacgatgttacgttg
gcacgtcatattgccgcccaagggtttaaggtgggctttttagacggggctaaggtattg
aaagtgagaatgtatgaaggggcgttagaaacttggaaggaatggggacgcagccttgat
ttaaaagatgcctctccccgcgctcaaatttggggagatttatggttactatcggcagta
caaggtttacctttattgattgtaactggttacttgctgattaattcctggcaactaatg
ttgcctgtcaagttgttattgggactgaatgtatttctactggtgattcgctttgctatg
ctattggcgatcgctccttcctacgaccgtcaaaatgctaaagctggctggctgttttgg
ttatcacccttggccgatgctttagcagttctgcgaatcttcttatctgcttttcgcact
cccagggaatggagaggtagaacttatagcaaggaatag

DBGET integrated database retrieval system