KEGG   Nostoc sp. PCC 7120: all0278Help
Entry
all0278           CDS       T00069                                 

Gene name
chlD
Definition
Mg chelatase subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    all0278 (chlD)
Enzymes [BR:ana01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     all0278 (chlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(306868..308904)
Genome map
AA seq 678 aa AA seqDB search
MPAPTINPTITAFPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHAL
LPPIEVVKGSLSNCDPNHPEEWDDYLLAEYADKNIQDVPTEIIPSPFVQIPLGVTEDRLL
GSVDVEQSVKQGDTIFQPGLLATANRGVLYVDEINLLDDQISNQLLTVLSEGRNQIEREG
ISFQHPCKSLFIATYNPEEGALREHLLDRIAIALSADGVLGLDQRVEAVEQAIAYSKSPQ
DFLQQYNEDLDSLKTQIILAREWLKEVTITQEQITYLVDEAIRGVVQGHRAELFAVRVAK
AAAALEGRTTVNAEDLRRAVELVIVPRATVIQTPPPDQPPPPPPPPPPQSQDESEEEQEE
EQENNEDKPEEQEQQEPPDIPEEFIFDPEGVILDNSVLYFAQMAQRQGKSGSRSIIFSDD
RGRYIKPMLPKGKVRRIAVDATLRAAAPYQKARRERQPDKKVIVEQGDIRSKRLVRKAGA
LVVFVVDASGSMALNRMQSAKGAVMQLLTEAYQNRDQVALIPFRGEQAEVLLPPTRSIAL
ARNRLERLPCGGGSPLAHGLTQAVRVGVNAQMGGDIGQVVIVAITDGRGNIPLSRSLGEP
QESGEKPDIKAELLDIAARIRALGMQLLVIDTESKFVSTGFAKELAKTSGGKYYHLPKAT
DKAIAAMTKGAIADLKSR
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgcctactattaatcccacaattactgcttttcccttgacagccgtagtcggt
caagaagccatcaaactagcgttgctgttagcagcagtcgatcctggtttggggggagta
gcgatcgcaggtcgtcgtggtacggcaaaatctgtaatggctcgtgctatccacgcccta
ctcccacccatcgaagttgttaaaggctcattgagcaattgcgaccccaaccacccagaa
gaatgggatgattatctattggcggagtacgctgacaagaatattcaagatgtccccacg
gaaattatcccctcgccttttgtgcagattccccttggtgtgacagaagaccgactcctg
ggttctgtggatgtggaacagtcggtcaagcaaggagacaccatatttcagccaggttta
ctcgccacagctaaccggggtgtgctgtatgtggatgaaatcaatttattagatgaccaa
atatccaaccaactattaacagtcctctcggaaggtcgtaaccaaattgagcgcgagggg
attagttttcagcatccttgcaaatcgctatttatcgccacctacaaccccgaagaaggc
gcattacgggaacacttattagatagaattgcgatcgctctttcggctgacggtgttctc
ggactagaccaaagagtagaagcagtagaacaagcgatcgcctattccaaatccccccaa
gattttctccagcaatacaacgaagatttagactcactcaaaacccaaattatcttggcg
cgggaatggttgaaggaagtcaccatcactcaagaacaaataacctacttagtagacgaa
gccattcgcggcgttgtccaaggtcatcgtgctgagttatttgctgtgcgggttgccaaa
gcggcggcggctttagaagggcggacaaccgtcaacgctgaagatttgcggcgagcggtg
gagttggtaattgtaccacgagcaacagttatccagacaccaccaccagaccagccaccg
ccaccacccccgccaccaccaccacaaagtcaggacgagtcagaggaagaacaagaagaa
gaacaggaaaacaacgaagataaaccagaggaacaagaacagcaagaaccccctgatatt
cccgaagaatttatcttcgacccagaaggggtaattctggataacagcgtcctgtatttt
gctcagatggcacaacgccaaggtaaatctggtagtcggagtatcatcttttccgacgac
cgggggcgctatattaagcctatgttgcctaaggggaaagtgcgacgcattgctgtagat
gccaccctcagggcagctgcaccctatcaaaaagcacgacgagaaagacagcctgataaa
aaagttattgttgagcaaggtgacattcgctcaaaacgcttggtacgcaaagccggggcg
ttggttgtttttgtggtagatgcttctggctcaatggccttaaatcggatgcagtccgcg
aaaggtgcggtgatgcaactactcaccgaagcttatcaaaaccgtgaccaagtagctttg
attcccttccggggagaacaagcagaggtattactaccaccaactcgttctattgcctta
gcacggaaccgactggaaagattaccctgtggtggtggttcgcccctagctcatggctta
acccaagctgtacgcgtcggtgtcaatgcccaaatgggtggagatattgggcaagttgtc
attgtagctatcaccgacggccggggtaatattcctctatcacgttctttgggtgaacca
caagaatccggagaaaaaccagatatcaaagcggaactattagacatcgccgccagaatc
cgggctttggggatgcagttactagttatcgataccgaaagtaaatttgtctctaccggc
tttgctaaagaattagcgaaaacctcaggaggcaaatattatcatctacctaaagccacc
gataaagccattgctgctatgactaaaggggcgatcgctgatttaaaatctcggtag

DBGET integrated database retrieval system