KEGG   Nostoc sp. PCC 7120: all0375Help
Entry
all0375           CDS       T00069                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ana00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    all0375 (ruvA)
Enzymes [BR:ana01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     all0375 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(438969..439610)
Genome map
AA seq 213 aa AA seqDB search
MISYLKGIVAGIQNVGSNRVILTLEVNGMGYDLQIPQRLAKQLPTTGDLVQIFTHYQVRE
EIPLLYGFSSPAERDLFRHLLSVSGVGAASAIALLDTLELPDLVQAIIAANVQILIQAPG
VGKKIAERVCLELKAKLIEWRKSAGFFVATEGPAPGILEEVQMTLFALGYTAHEVSHALH
VVSEDIGLPKDAYVEDWIKQAIAHLSSSEQVSH
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgattagctatctcaaaggtatagtcgccggtattcaaaacgtaggcagcaatcgtgtc
attctcactctcgaagtgaatggtatgggctatgatttgcaaattccccaacggttagcc
aagcaattacccacaaccggagatttggtacaaatatttacccattaccaagtccgggaa
gaaattcccttgctttatggtttctcttccccagccgaacgggatttattccgccaccta
ttgtctgtgagtggtgtaggtgcagccagcgcgatcgctctcttagacaccttggaacta
cccgatttagtccaagccatcattgctgctaacgtccaaatcttaattcaagccccaggt
gtgggcaaaaaaatcgccgagcgtgtttgtttggaactcaaagccaaattaatcgagtgg
cgcaaatcagcaggcttcttcgtcgctaccgaaggcccagcccccggcattctcgaagaa
gtgcaaatgactctattcgccctgggttacaccgcccatgaagttagccacgctttacac
gtagtcagtgaagacatcggattacccaaggatgcctatgtagaagactggatcaaacaa
gcgatcgcccacctcagcagtagtgagcaagttagtcattag

DBGET integrated database retrieval system