KEGG   Nostoc sp. PCC 7120: all0603Help
Entry
all0603           CDS       T00069                                 

Definition
(GenBank) putative transcriptional regulator
Organism
ana  Nostoc sp. PCC 7120
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(701461..701766)
Genome map
AA seq 101 aa AA seqDB search
MKTKPFDELRKKMTPEQQAESEMQANLVLLKLTLSELRESLGQTQGDVAKNMGVVQSALS
KIEHQDDIQISTLSRYIKSLGGSLTIIACFPDQEVVISQFD
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgaagccatttgatgaacttcgtaaaaaaatgactccagaacaacaggcagaa
agtgagatgcaggcaaaccttgtattgctcaaattaacactttccgaacttcgagagtca
cttggacagacacaaggtgatgtggcaaagaatatgggagtagtacaatcggcactttca
aagattgagcatcaggatgatattcaaatatccaccctctctcgatacattaaatctctt
ggtggaagtctgacaataattgcctgttttcctgatcaggaggttgtgatttctcagttc
gattga

DBGET integrated database retrieval system