KEGG   Nostoc sp. PCC 7120: all1716Help
Entry
all1716           CDS       T00069                                 

Definition
two-component hybrid sensor and regulator
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ana00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    all1716
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    all1716
Enzymes [BR:ana01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     all1716
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     all1716
Two-component system [BR:ana02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   all1716
Bacterial motility proteins [BR:ana02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    all1716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2061373..2065374)
Genome map
AA seq 1333 aa AA seqDB search
MTEILSRTTQMPVSEVQEGMAVEPNHVYVIPPNTRMTIAQGVLKLIPLEKIRGVSMTVDS
FLISLAEDRGNRAIGVILSGGDSDGARGLETIKAAGGITFAQCEESAKVSSMPNTAVASG
HVDFILTPQKIAEELANISSHPYVNHPTPSKQVDIMPEGTDSLSIIFSLLRAATGVDFTY
YKQTTLKRRIQRRMMLYKLEKLEDYAQYLQNNQAEVLALYQDLLIKVTGFFRDPEAFEAL
KTNVFPIITKNRTPDSPIRIWVAGCSTGEEAYSMAICLLEFLADKVANTPINIFATDINE
VAIEKARIGVYKPSEVADVSPERLQRFFVQVEGGYQISKPVRELCIFARQNLISDPPFSR
LDLITCRNVLIYLGATVQKKLLPIFHYGLKSTGFLMLGTSETVGEFFDLFNLVDRKNKIY
SRKIAPARLGIDFISQNYPLEAFNPQPKINEDVLNNQEMQKEADRIVLNQYAPVGVIVND
DLEILQFRGQTSSYLQPAPGRPSFNLLKMAKEELRLELRTAIHQAKKQEMSVRKEGIELR
EGEQVRQVRIDAIPFQLTAGGERYFLVLFEDMPPSVTAAPQAASKNPNVSSRQRQQMNDE
QEINRLGQELATTKEYLQSIIEEQQATNQDLRAANEEILSSNEELQSTNEELETAKEEIQ
ATNEELNTINEELQRRNVESNQVSNDLQNLLSSINIPILMLGGDMRIRRFTPTAGRIFNL
IVTDIGRPLSDINHKLTIPDLEAQILEVVGTLNLKTQEVQDNDGHWYDLRIRPYRTIDHK
IDGAVVVLVDIDALKRSTEELRASKDYAEAIVATIRESLVILDIDLQVITANQFFYEKFQ
VTPEETEHHLIYEIGDGQWNIPQLRSLLEDVLPQQTQFQNLEVEHNFERIGQKIMRLNAR
KMTLLDNRRMILLVIEDITQQKQLEAERTHLLAQEQSARNAAEAANHAKDEFLSILSHEL
RNPLNSMLGWANLLRTHQLEEVTVNQGLEAIERSAQAQNHLISDLLDVSRISSGRLRMDA
QEVELIPVIEAAIAVVRLAAEAKNIQIETKLDPTHTPMLGDPIRLQQVIWNLLSNAIKFT
PTKGRIDVTLEYTYFQAQIQVKDTGAGIKADFLPYVFERFRQADGTRTRSNQGLGLGLSI
VRHLVELHGGTVEVESQGEGQGSTFTIKLPVQANRKENPVATVQEPVTLTNVPEIPTDNL
PSLEGVRVLIVDDEPDIRLLFKLVLEEYGVKVTEVASAREALSKLRENPGCYDILLSDIG
LPEEDGYLLMRQVRALSAEEGGQIPAAALTAYAGDSEYTQALAAGFQTHIAKPIEPYQLV
SLVASLAGRVRGV
NT seq 4002 nt NT seq  +upstreamnt  +downstreamnt
ttgacggagattctttcccgaacaacccaaatgcctgtatcagaagtacaggaggggatg
gcggtggaaccaaatcatgtttacgtcattcctcccaataccagaatgaccattgctcaa
ggggtactaaaactgatacctctggaaaagatccggggtgtatcgatgacagtcgatagt
ttcttgatttccttagcagaggatcggggaaacagagccattggcgtgattttatcaggg
ggcgattccgatggcgcacggggactagaaacaatcaaggcggcgggtggtattaccttt
gcccagtgcgaggaatcagccaaagtcagtagtatgccaaatacagccgtagcttctggt
catgtagactttatcctcaccccccaaaaaattgccgaggaattggcaaatatcagttct
catccctatgttaatcatccaacacccagcaaacaggttgacatcatgccggaaggtact
gattcactctccatcatctttagtctgctacgggctgctaccggggttgactttacctat
tacaagcagactaccctcaagcggcgcatccagcgacgaatgatgttgtacaaactggaa
aagctggaggattacgcccagtatctgcaaaataatcaggcggaagtgctggcattatat
caagatttattaatcaaggtgacagggtttttccgagaccccgaagcctttgaagcctta
aagactaatgtctttcccattattactaagaatcgtacgccggattcacccatccgtatc
tgggtagcaggatgttcaactggtgaagaagcctactctatggctatatgcttactagaa
tttttggcagataaagtcgccaatacacccattaatatttttgccactgatataaatgaa
gtggcgattgagaaagctagaatcggcgtttacaaacctagcgaggtagcagatgtctct
ccagaacgtctacagcgcttctttgtgcaggtagaaggtggttaccaaattagtaaacca
gtgcgggaactgtgtattttcgccagacaaaacttgatcagtgatcccccattttctcgg
ctggatttaattacctgtcgcaatgtcttaatttatttgggagctactgtgcagaagaag
ctcctgccaatattccactatggtctcaaatcaactggctttttgatgttaggcacatcg
gaaacagtgggtgaattttttgatttgtttaacttggtagacagaaagaacaagatttat
tcccgaaaaatagctccggcgcggctgggtatagattttatttcacaaaactatcctttg
gaagcatttaacccccagccaaaaatcaacgaggatgttttgaataatcaggaaatgcaa
aaagaagctgaccggattgtattaaatcaatatgctcccgttggtgttattgttaacgac
gatttggagattttgcagtttcggggacaaactagttcatatctgcaacctgcacctggt
agaccaagctttaatttgctgaagatggcaaaagaagaattgcggctagaactacgtacc
gccattcaccaagcgaaaaaacaggaaatgtcggtgaggaaagaaggcatagaactcagg
gaaggtgaacaagttaggcaagtgaggattgatgccattcctttccaactaactgctggg
ggagaacgctactttttagttctgtttgaggatatgccgccatcagtgactgcggcacca
caagcagcgagcaaaaatcccaacgttagctctagacagcgccaacaaatgaatgatgag
caggaaattaaccgcctcggacaggaactagcaactacaaaagagtatctgcaatcaatt
attgaagaacagcaagccaccaatcaagacctgagagcagccaacgaggaaattctttcc
agcaacgaagagctgcaaagtaccaatgaggaactggaaactgctaaagaagaaattcag
gccaccaatgaagaattaaacacaattaacgaagaactacaacggcgaaatgtcgaatca
aatcaggtcagcaacgatttacagaatctacttagtagtatcaatattcccatcctgatg
ctgggaggagatatgcggattcggcgctttactcccaccgcagggagaatctttaacctg
attgttacagatataggcagaccactgagtgatattaaccacaaattgactattcctgac
ttagaggcacaaattctagaggtagtaggtacactcaacctgaaaacccaggaagtccaa
gacaatgatgggcattggtatgacctgcgaatcagaccttatcggacaatagaccataaa
attgacggtgctgtagtcgtgttagttgatattgatgccctgaaacgcagcaccgaagaa
ctcagagcatctaaagattacgcggaagcgattgtggcaaccatccgggaatctttagta
attctggatatagatttacaggtgattaccgccaatcagtttttctacgaaaaattccag
gtaacaccagaagaaacagaacaccacctcatctatgaaattggggatggacagtggaat
attcctcagttgcgatcgctcttagaagacgttctcccccaacaaacccaatttcaaaac
ctagaagttgagcataacttcgagcgaatcgggcagaaaatcatgcggctcaatgcccgg
aaaatgacgctattagacaataggcgaatgattctcctggtaattgaagatatcacccag
cagaagcagctagaggcagaacgcacccatcttttggctcaagaacaatcagcccggaat
gcggctgaagcagccaatcatgccaaagatgagtttttatcaattctctcccacgaactg
cggaacccgctcaattccatgctcggttgggctaatttgctacgaacgcaccaactagaa
gaagttacagttaaccagggtctagaagccatcgagcgcagcgcccaggctcaaaaccat
ctcatcagcgatttgttagacgtttcccgcattagctcaggtaggctgaggatggatgct
caagaagttgagctgattcctgtaattgaagcagcgatcgctgtggttcgtctagcagcc
gaagccaaaaatattcaaattgaaactaagttagatcccacacacacaccaatgctaggc
gatccaattcgcttacaacaggtcatatggaacttactatctaacgccatcaaattcacc
ccaaccaaaggcagaattgatgtcacactagagtacacttatttccaagcgcaaattcaa
gttaaagacacgggtgctggtatcaaagctgactttctcccctacgtttttgaacgcttc
cgccaagctgatggcaccagaacacgctcaaatcaaggcttgggattaggactttctatt
gtgcgccacttggtagaactccacggtggtacagtggaggtagaaagccaaggtgagggt
caagggtcaacctttacaatcaagctacctgtgcaagctaaccgaaaagaaaatcctgtg
gcgacggttcaagagccagtcaccttaaccaatgtgccagaaatacccacagataatcta
ccttccctagaaggtgtgcgggtgctgatagtagatgatgaaccagatatccgcctacta
ttcaaattagtacttgaagaatacggggttaaagtcacagaagtagcttctgcaagggag
gctttatcaaaactcagagaaaatcccggctgttacgacatactcctatctgacatcggt
ctaccagaggaagatggttatttattaatgcgtcaggtgagggcgctgagtgctgaagaa
ggtggacaaattcccgccgccgcactgacagcctacgccggtgattcagaatacacacag
gctttagcagcaggttttcaaactcacatcgctaaacccatcgaaccatatcagttggtg
tctttagttgcttccttggcgggaagggttaggggggtgtag

DBGET integrated database retrieval system