KEGG   Nostoc sp. PCC 7120: all1784Help
Entry
all1784           CDS       T00069                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    all1784
Enzymes [BR:ana01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     all1784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2143162..2144085)
Genome map
AA seq 307 aa AA seqDB search
MSIIVFGSINIDLVATAPKLPGAGETLLGEDFFKVPGGKGANQAVALARLGVPTQMVGRV
GAQSFGAELMQNLQDAGVQTDNIFVDETASSGVAMITVAHNGENQIVVIPGANGRVNQVD
VERLSRILPTATALLLQLEIPVPAVIAAAQAARSNNITVILDPAPAPSDLPTELYSFVDI
ITPNEVEAGQLVGFPVDGEDAARKAAGVLLQKGVKSAIVKLGAKGVVCATNKETFFVPAF
SVDTLDTVAAGDAFNGGLATALYSGLSLHQAVIWGAAAGALAATKLGAQTSLPDKLTFEA
FLKERVL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagcattatcgtcttcggtagcatcaatatagatttagttgccacagcacccaagtta
ccaggtgcaggagaaaccttactgggagaagactttttcaaggttcctgggggtaaaggt
gcaaaccaagctgtagcattagcaagattgggagttcctacccagatggtgggacgcgtc
ggcgcacagagttttggtgcagaactgatgcaaaatctgcaagacgctggcgtacaaact
gacaatatttttgtagatgaaactgcaagttctggagtggcgatgatcaccgtagctcat
aacggtgaaaatcaaatagttgtcattcctggtgctaatgggcgagtcaatcaagtagat
gtagaacgattatcacgcatattaccaacagctacagccctgctattacaattagaaatt
cctgtacctgccgttatcgcagctgcccaagcagcaagaagtaacaatattacagtaatt
ttagaccccgcacctgcaccatcagatttaccaacagaactttactcctttgttgatatc
attacccccaatgaagtagaagctgggcaacttgtgggctttccggtagacggggaagat
gcagcgcgaaaggcagcaggggtgttattgcaaaagggcgtgaaaagtgcgatcgttaaa
ctgggcgctaaaggtgttgtttgtgccacaaacaaagagacattttttgtcccagccttc
tccgtggatacgcttgatactgtagcggctggtgatgcctttaatggtggtttagcaaca
gcactttattctgggctttccttacatcaggcagttatttggggtgcggcggcaggtgct
ttagccgcaacaaaattaggcgcacaaacttcgttgcctgacaagttgacatttgaggcc
ttcctcaaggaaagggttttgtga

DBGET integrated database retrieval system