KEGG   Nostoc sp. PCC 7120: all1811Help
Entry
all1811           CDS       T00069                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    all1811
Enzymes [BR:ana01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     all1811
Exosome [BR:ana04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   all1811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2176667..2178169)
Genome map
AA seq 500 aa AA seqDB search
MQISSSGYILALDLGTTGNRAFIFNNAGKIVAQAYKELTQHYPQPGWLEHDAEEIWQDTC
WVMKTAIVNAQISPSEIAAIGLTVQRETCLLWDKTTGRPLHKAIVWQDRRTAPLCHQLQE
KGYAQEIYSRTGLVVDAYFSATKLRWLLDYITGVDLKNVLAGTIDTWILWKLTGGKVHAT
DHSNASRTMLMNLKTGEWDEQLLEILQIPAHILPQIQPSLGKFGVTDTSLLDAAIPITAI
LGDQQAALFGHGCDRPGLMKCTYGTGSFLVAHTGSNIVRSQHQLISTIAWTQADKQENIN
IGYALEGSMFTSGACIQWLRDGIKLIKTAAETETMANQVADNGGVYFVPAFSGLGAPYWD
MNARGAFFGITASVQPQHLVRAVLEAIAYQVLEVVQAINASCSSPMQRLIVDGGACENNF
LMQFQADVLGIPVERPTMRDTTVQGAAFAAGLAVGFWDSYTALVNQRQIDRIFEPGEGSQ
NATANFAIWQKAVKRSLDWV
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcagatatcatcttccggctatatcctagcgttggacttgggaacaactggaaaccgg
gcatttatctttaacaatgcaggtaaaatagttgctcaagcatataaggaactaacacaa
cattacccccaaccaggatggttagagcatgacgcggaagaaatctggcaagatacctgc
tgggtgatgaagacagccatcgtcaatgcacaaatatctcctagtgaaattgcggctata
ggtttgactgtacaacgggaaacttgcctactctgggacaaaaccacggggagaccatta
cataaagccattgtttggcaagaccgccgcacggctcccctgtgtcatcagttacaggaa
aaaggctatgctcaggaaatttacagtcgtactggtttagtagttgacgcttatttctcc
gcaactaaactccgatggttattagactacatcacaggcgttgatttaaaaaatgttttg
gcaggtacaatcgatacctggatattgtggaaattaacaggtgggaaagtccacgccacc
gaccacagcaatgctagccgcaccatgttgatgaatttgaaaactggtgagtgggatgag
caactactagagattttgcaaattcctgcccatattctgccgcaaattcaacccagtttg
ggaaaatttggtgttacagataccagcttattagatgcagctatccccatcacagccatt
ttaggcgatcaacaggcagctttgtttggtcatggctgcgatcgccccggtttaatgaaa
tgtacttatggcactggtagctttttagtagctcatactggctctaatattgttcgttct
caacatcaattaatttctacaatcgcctggacacaagccgataaacaggaaaatatcaat
attggctatgctctagaaggcagtatgtttactagtggtgcttgtatccaatggttgcgt
gacggcatcaagctaattaagacggctgctgaaactgagaccatggcaaatcaagtagcc
gataacggtggggtgtactttgtccccgcttttagtggactaggcgcaccctactgggat
atgaacgctagaggagctttttttggcattacagccagcgtccaaccacagcatttagtc
cgggctgtattagaagcgatcgcctatcaagtgttagaagtagtacaagccatcaatgcc
tcttgtagtagccccatgcagcgcctaattgtcgatggtggtgcttgtgagaacaatttc
ctcatgcagttccaagcagatgttttaggtattcccgtagaacgtcccaccatgcgcgac
acaacagtacaaggtgcagccttcgccgcaggtttagccgtgggattttgggatagttac
acagcattagttaaccaacgccagatagaccgcatttttgaaccaggagaaggaagccaa
aacgccacagccaattttgcgatatggcaaaaggcagttaaacggagtcttgattgggtg
tag

DBGET integrated database retrieval system