KEGG   Nostoc sp. PCC 7120: all1831Help
Entry
all1831           CDS       T00069                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ana  Nostoc sp. PCC 7120
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    all1831
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    all1831
Enzymes [BR:ana01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     all1831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2195126..2196223)
Genome map
AA seq 365 aa AA seqDB search
MPALQRLERFGNHLIMGISGTSLSDEDKRALGELKPIGVIFFAKNFLDGVPYAVWLETFQ
ELHSQIQEYAERDSMFFTLDHEGGRVVRTPLPITRFPQALLLRSQAREVAKATAIELKSL
GINLSWSPVADIYSHPQNPIIGSRAFGNTPDTAAAGAREYYLGLTEAGIVGCAKHFPGHG
DTSKDSHVELPILNLTPEELQNRELIPFKALIEEGIPLIMTAHILFPKIDPDLPATLSRP
ILKTILRKELGFQGVVVSDDLDMKAVSDMFMQSGTVARAFNAGCDLFIVSRNIHASSIER
TYKIAEDFTDCLTDGSLAESVVESAKERIERLLAVTPEYSVQALDKDTLVRHAELAIACC
FENSQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgccagcattgcagagactagaacgctttggaaatcacttaataatgggtatttctggt
actagtttgagtgatgaagataaacgcgctttgggtgaattgaaaccaataggggtaata
ttctttgctaaaaactttttagatggtgtaccttacgcggtttggctggaaacttttcag
gagttacatagccagatacaagaatatgcagaacgcgattccatgttttttaccttagac
catgagggaggacgcgttgtaaggacacctttaccgattacgagatttcctcaggcgttg
ttgttgcgatcgcaggctcgtgaagtagcaaaagccacggcaattgaattaaaatctttg
ggcatcaacttatcttggtcgcctgtagctgatatttattcccacccgcaaaatcctatt
atcggttctcgcgcttttggtaatacccctgatacggcggcggctggtgcgcgggaatat
tatttgggactgacagaagctggaattgtgggatgcgccaaacatttccccggacatggt
gatacgagtaaggactcccatgtggaattaccaattctcaacctgactccagaggaatta
caaaatcgagaacttattcccttcaaagctttgattgaagaagggattcccctcattatg
accgcccatattttatttcccaaaatcgacccagatttaccagctaccctatcccgcccc
atcctcaaaactatattgcggaaagaacttggttttcagggtgtggtcgtatctgacgac
ttagacatgaaagcagtttcagatatgtttatgcaaagtggtacagtcgcgcgggctttt
aatgctggctgtgatttatttattgtttctcgtaatatccacgcgtcttctatcgagcgt
acatataaaattgcggaagattttactgattgtttaactgatggtagcttggctgagtca
gtggtagagtccgctaaggagagaatcgaaagactattggcagtaactccagaatattct
gtacaggcgttagataaagatactttagtccgtcatgccgaattagcgatcgcctgttgt
tttgagaatagtcaatag

DBGET integrated database retrieval system