KEGG   Nostoc sp. PCC 7120: all1831Help
Entry
all1831           CDS       T00069                                 

Definition
(GenBank) putative sugar hydrolase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00520  Amino sugar and nucleotide sugar metabolism
ana01100  Metabolic pathways
ana01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    all1831
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    all1831
Enzymes [BR:ana01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     all1831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: BAB73530
CyanoBase: all1831
CYORF: all1831
UniProt: Q8YVY6
Position
complement(2195126..2196223)
Genome map
AA seq 365 aa AA seqDB search
MPALQRLERFGNHLIMGISGTSLSDEDKRALGELKPIGVIFFAKNFLDGVPYAVWLETFQ
ELHSQIQEYAERDSMFFTLDHEGGRVVRTPLPITRFPQALLLRSQAREVAKATAIELKSL
GINLSWSPVADIYSHPQNPIIGSRAFGNTPDTAAAGAREYYLGLTEAGIVGCAKHFPGHG
DTSKDSHVELPILNLTPEELQNRELIPFKALIEEGIPLIMTAHILFPKIDPDLPATLSRP
ILKTILRKELGFQGVVVSDDLDMKAVSDMFMQSGTVARAFNAGCDLFIVSRNIHASSIER
TYKIAEDFTDCLTDGSLAESVVESAKERIERLLAVTPEYSVQALDKDTLVRHAELAIACC
FENSQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgccagcattgcagagactagaacgctttggaaatcacttaataatgggtatttctggt
actagtttgagtgatgaagataaacgcgctttgggtgaattgaaaccaataggggtaata
ttctttgctaaaaactttttagatggtgtaccttacgcggtttggctggaaacttttcag
gagttacatagccagatacaagaatatgcagaacgcgattccatgttttttaccttagac
catgagggaggacgcgttgtaaggacacctttaccgattacgagatttcctcaggcgttg
ttgttgcgatcgcaggctcgtgaagtagcaaaagccacggcaattgaattaaaatctttg
ggcatcaacttatcttggtcgcctgtagctgatatttattcccacccgcaaaatcctatt
atcggttctcgcgcttttggtaatacccctgatacggcggcggctggtgcgcgggaatat
tatttgggactgacagaagctggaattgtgggatgcgccaaacatttccccggacatggt
gatacgagtaaggactcccatgtggaattaccaattctcaacctgactccagaggaatta
caaaatcgagaacttattcccttcaaagctttgattgaagaagggattcccctcattatg
accgcccatattttatttcccaaaatcgacccagatttaccagctaccctatcccgcccc
atcctcaaaactatattgcggaaagaacttggttttcagggtgtggtcgtatctgacgac
ttagacatgaaagcagtttcagatatgtttatgcaaagtggtacagtcgcgcgggctttt
aatgctggctgtgatttatttattgtttctcgtaatatccacgcgtcttctatcgagcgt
acatataaaattgcggaagattttactgattgtttaactgatggtagcttggctgagtca
gtggtagagtccgctaaggagagaatcgaaagactattggcagtaactccagaatattct
gtacaggcgttagataaagatactttagtccgtcatgccgaattagcgatcgcctgttgt
tttgagaatagtcaatag

DBGET integrated database retrieval system