KEGG   Nostoc sp. PCC 7120: all1847Help
Entry
all1847           CDS       T00069                                 

Definition
(GenBank) similar to protein-glutamate methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana02020  Two-component system
ana02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ana00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    all1847
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    all1847
Enzymes [BR:ana01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     all1847
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     all1847
Two-component system [BR:ana02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   all1847
Bacterial motility proteins [BR:ana02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    all1847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest
Motif
Other DBs
NCBI-ProteinID: BAB73546
CyanoBase: all1847
CYORF: all1847
UniProt: Q8YVX2
Position
complement(2210361..2210933)
Genome map
AA seq 190 aa AA seqDB search
MSYKIVVIGTSLGGLSALQTVLGNLPADFQLPVAIVQHRHKNSDGTLRGMIQESALLPVR
EVEDKDEILPGQVYLAPADYHLLVEPGYFALSTDEPVSYARPSIDVLFESAADIYGEQVI
GVILTGANQDGMQGLKKIKARGGITVVQEPTTAASAIMPTAAISAVTVDWIVSLSEISPL
LVNLGYSTRK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtgtcttataaaattgtagttattggcacttctttagggggattatcagcactgcaaact
gttctcggaaatttaccggctgacttccaacttccagtggcgatcgtccaacatcgtcat
aaaaattctgatggcactctcaggggaatgatccaagaatctgctttgttacccgttaga
gaggtggaagacaaggacgaaattttaccaggacaagtttacctagctccagccgattat
catttattggttgaacccggttattttgccctgtctactgatgagcctgtttcttatgcc
agaccatctattgatgtactgtttgaatcagctgccgatatttatggggaacaagtcatt
ggtgtaatattaacaggggctaatcaggacggtatgcaagggctgaaaaaaattaaagct
agggggggtatcactgttgtgcaggaacccaccacagccgccagcgccatcatgccgaca
gcagcaatatctgccgttacagtagactggattgtgtcactttcagaaatttctccccta
ctagtaaatcttggttactctacacggaaatga

DBGET integrated database retrieval system