KEGG   Nostoc sp. PCC 7120: all2072Help
Entry
all2072           CDS       T00069                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    all2072 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    all2072 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    all2072 (thrC)
Enzymes [BR:ana01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     all2072 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(2478215..2479306)
Genome map
AA seq 363 aa AA seqDB search
MTLSLSVAKSHRQPWPGLIEAYREYLPVSDKTPVVTLLEGNTPLIPVPAIAERIGRQVSV
FVKYDGLNPTGSFKDRGMTMAISKAKEDGAKAVICASTGNTSAAAAAYARRGGMKAFVLI
PDGYVALGKLAQALLYGAEVLAIKGNFDQALEIVREMAESYPITLVNSVNPYRLEGQKTG
AFEVVDALGNAPDWLCIPVGNAGNITAYWMGFCQYHQAGKCDRLPQMMGFQAAGAAPLVN
GQPVSHPETIATAIRIGKPASWDKAIAAQSASQGSFNAVTDEEILDAYRLLASSEGIFCE
PASAASVAGLLKVKDQVPTGATVVCVLTGNGLKDPDTAIKHSHSQFKQGIEADLSSVAKA
MGF
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgactttgagcttgtctgttgctaaatctcatcgccaaccctggcccggactgatagaa
gcctatcgtgagtacttacctgtcagcgacaaaacgccagttgtgactttgttggaaggt
aacactcctttaattccggtgccagcgatcgcagaacgtatcggtagacaagtaagtgtg
tttgtgaaatacgatggtctcaaccccactggcagtttcaaagacagggggatgactatg
gcgatttccaaagctaaggaagacggagccaaagcggtcatttgtgcgagtacaggcaat
acctcagccgcagccgcagcctatgctcgtcgtggtgggatgaaggcttttgtattgatt
cctgatggttatgttgccttgggtaagctggcgcaagcactactttatggtgcagaagta
ttggcaattaaaggcaacttcgaccaagctctagaaatcgtccgggaaatggcagaaagt
tatcccatcacgttagtaaactcagtcaatccctaccgcttggaaggtcaaaaaacagga
gcttttgaagtggtggatgctttgggtaatgccccagactggttgtgcatcccagttggt
aacgcgggaaatatcacagcatattggatgggtttttgtcaatatcatcaagccgggaaa
tgcgatcgcctaccccagatgatgggcttccaagccgcaggtgcagcccccttggtaaat
ggtcagcctgtatcccatcccgaaaccatcgctaccgccattcgcattggcaaaccagcg
agttgggataaagcgatcgcagcccaatcagccagtcaaggaagttttaacgccgtcact
gatgaagaaattctcgacgcataccgactattggcatcatcagaaggtattttctgcgaa
cccgctagcgctgcttccgtcgccggcttattaaaagtcaaagaccaagtacccacaggc
gcaacagtcgtatgtgtcctcacaggtaacggtcttaaagacccagatacagcaattaaa
cacagtcacagccaattcaaacaaggtattgaggcagatttaagctctgtagccaaggcg
atgggattttag

DBGET integrated database retrieval system