KEGG   Nostoc sp. PCC 7120: all2072Help
Entry
all2072           CDS       T00069                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00260  Glycine, serine and threonine metabolism
ana00750  Vitamin B6 metabolism
ana01100  Metabolic pathways
ana01110  Biosynthesis of secondary metabolites
ana01120  Microbial metabolism in diverse environments
ana01230  Biosynthesis of amino acids
Module
ana_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    all2072 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    all2072 (thrC)
Enzymes [BR:ana01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     all2072 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C TPP_enzyme_N ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: BAB73771
CyanoBase: all2072
CYORF: all2072
UniProt: Q8YVA9
Position
complement(2478215..2479306)
Genome map
AA seq 363 aa AA seqDB search
MTLSLSVAKSHRQPWPGLIEAYREYLPVSDKTPVVTLLEGNTPLIPVPAIAERIGRQVSV
FVKYDGLNPTGSFKDRGMTMAISKAKEDGAKAVICASTGNTSAAAAAYARRGGMKAFVLI
PDGYVALGKLAQALLYGAEVLAIKGNFDQALEIVREMAESYPITLVNSVNPYRLEGQKTG
AFEVVDALGNAPDWLCIPVGNAGNITAYWMGFCQYHQAGKCDRLPQMMGFQAAGAAPLVN
GQPVSHPETIATAIRIGKPASWDKAIAAQSASQGSFNAVTDEEILDAYRLLASSEGIFCE
PASAASVAGLLKVKDQVPTGATVVCVLTGNGLKDPDTAIKHSHSQFKQGIEADLSSVAKA
MGF
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgactttgagcttgtctgttgctaaatctcatcgccaaccctggcccggactgatagaa
gcctatcgtgagtacttacctgtcagcgacaaaacgccagttgtgactttgttggaaggt
aacactcctttaattccggtgccagcgatcgcagaacgtatcggtagacaagtaagtgtg
tttgtgaaatacgatggtctcaaccccactggcagtttcaaagacagggggatgactatg
gcgatttccaaagctaaggaagacggagccaaagcggtcatttgtgcgagtacaggcaat
acctcagccgcagccgcagcctatgctcgtcgtggtgggatgaaggcttttgtattgatt
cctgatggttatgttgccttgggtaagctggcgcaagcactactttatggtgcagaagta
ttggcaattaaaggcaacttcgaccaagctctagaaatcgtccgggaaatggcagaaagt
tatcccatcacgttagtaaactcagtcaatccctaccgcttggaaggtcaaaaaacagga
gcttttgaagtggtggatgctttgggtaatgccccagactggttgtgcatcccagttggt
aacgcgggaaatatcacagcatattggatgggtttttgtcaatatcatcaagccgggaaa
tgcgatcgcctaccccagatgatgggcttccaagccgcaggtgcagcccccttggtaaat
ggtcagcctgtatcccatcccgaaaccatcgctaccgccattcgcattggcaaaccagcg
agttgggataaagcgatcgcagcccaatcagccagtcaaggaagttttaacgccgtcact
gatgaagaaattctcgacgcataccgactattggcatcatcagaaggtattttctgcgaa
cccgctagcgctgcttccgtcgccggcttattaaaagtcaaagaccaagtacccacaggc
gcaacagtcgtatgtgtcctcacaggtaacggtcttaaagacccagatacagcaattaaa
cacagtcacagccaattcaaacaaggtattgaggcagatttaagctctgtagccaaggcg
atgggattttag

DBGET integrated database retrieval system