KEGG   Nostoc sp. PCC 7120: all2934Help
Entry
all2934           CDS       T00069                                 

Definition
hypothetical protein
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    all2934
   00330 Arginine and proline metabolism
    all2934
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    all2934
Enzymes [BR:ana01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     all2934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(3570447..3571451)
Genome map
AA seq 334 aa AA seqDB search
MSDQANQGDLEIRPSPLLKVINDLHSKYKSLKEGIVANYIPELAKVNPDLFSISIVTVDG
QVYQVGDYQQLFTIQSISKVFAYGLALEDHGRDYVLTRVGVEPTGEAFNAIILDEQSKRP
YNPMVNAGAIATTSLIKGAGATERLNRVLEMFRRYIGHDVFVDISVFTSERSTGHRNRAM
AHLMLNFGMIDRNIEEALDLYFQQCAVMVNCHDLAVMAATLANRGVNPITGEQAVNSRYI
KDILSVMYTCGMYNFAGEWAYKVGIPAKSGVCGGIMAVVPNLMGIAVFSPPLDIRGNSVR
GVKVCEELSQQLGLHLFECMKVGNGEWGVGNCEC
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcaagccaatcaaggagatttagaaatacgtccctctcccctattaaaggtg
atcaacgatttgcattctaaatacaagtcactcaaagaggggatagtagcgaactacata
ccagagctggccaaagtcaacccagacctgtttagtatttccatcgttacagtggatggt
caggtttatcaggtaggagattatcaacaactatttactatccagtctatttctaaagtt
ttcgcctacggactagcgttagaagatcatggacgggattatgtgttgactagggttggt
gtagaaccaacaggggaagcatttaacgcgattattttggatgagcagtcgaagcgacct
tataacccaatggtcaatgctggggcgatcgccaccactagtttaatcaaaggggctggg
gcaacggaacgcctcaatcgggtactagaaatgtttcgccgatatattggtcatgatgtg
tttgttgatatttccgtatttacctccgaacgcagtacaggacaccgtaatcgggcgatg
gcacatctcatgctcaactttggcatgatagatagaaatatagaagaagcattagaccta
tattttcagcaatgcgctgtgatggttaactgtcacgatctggcggtgatggccgctacc
ttggcgaacaggggtgtgaacccaatcacaggagaacaagcggtaaatagtagatatata
aaagatatcctcagcgtcatgtacacctgtgggatgtacaactttgctggagagtgggct
tataaagtcggtattccggcaaaaagcggcgtttgtgggggaattatggcagttgttccg
aatctgatgggaattgccgtgttttctccacctttagatattcgaggtaacagtgtgcga
ggagtgaaggtgtgcgaagaactttctcagcagttaggcttacatctatttgaatgtatg
aaagtgggaaatggagaatggggagtggggaattgtgagtgttga

  All links  
No link information was found.   
DBGET integrated database retrieval system