KEGG   Nostoc sp. PCC 7120: all3274Help
Entry
all3274           CDS       T00069                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    all3274
   00052 Galactose metabolism
    all3274
   00500 Starch and sucrose metabolism
    all3274
   00520 Amino sugar and nucleotide sugar metabolism
    all3274
Enzymes [BR:ana01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     all3274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(3947177..3948058)
Genome map
AA seq 293 aa AA seqDB search
MQINKVRKAVIPAAGFGTRLFPATKVVKKELFPIIDQDGRAKPVILAIVEEAISAGITEV
GIVVQPDDIGIFADLFKNPPAPELLQKLSPQNQEYSQYLQDLGQKVVLLTQSEQEGYGHA
VFCAKDWVGNEPFLLMLGDHVYKSDIKKSCAQQVVEIYAQVHQSVVGLTTMPAAIINKAG
CIAGVWQEFNSILELTQLAEKPNLDYAREHLRVEGMAEDEFLCVFGLYVLTPKIFDFLAD
SINQNLRDRGEFQLTNCLDKLCQAEGMTGYVVKGKCFDTGLPNTYRQSLIDFI
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattaataaagtaagaaaagccgtgattccggctgctggttttggtactagatta
tttccagctactaaagttgtgaaaaaagaactattcccaattattgatcaagatggtaga
gcaaagcctgtaattttagctattgtggaagaagctattagtgcaggaatcacagaagtt
ggtattgttgtacagcctgatgatataggaatttttgctgatttatttaaaaatccacct
gcaccagaacttttacaaaaactttcgccacaaaatcaagaatatagtcaatacttgcaa
gatttgggacagaaagttgttttattgacacaatcagaacaagaaggatatggccatgct
gttttttgtgccaaagattgggtaggaaatgaaccgtttttattaatgttaggtgatcat
gtttataaatccgacataaaaaaatcttgcgctcaacaagttgtagagatttatgcacaa
gttcatcaaagtgttgttggcttaactacaatgccagcagcgataattaacaaagctgga
tgtattgcaggagtatggcaagagtttaattccattttggaactaacgcaacttgcagaa
aaacccaatcttgattatgcgcgtgagcatttgcgggtagaaggtatggcagaagatgag
tttttatgtgtttttggcttgtatgtcctcacgccaaaaatatttgatttcctagcagat
agtataaaccaaaatttacgcgatcgcggtgaatttcagttaacaaattgtttagataaa
ttgtgtcaagcagaagggatgacaggatatgtggtgaaaggtaaatgttttgatacgggt
ctaccaaatacttatcgacagtcattaattgattttatatag

DBGET integrated database retrieval system