KEGG   Nostoc sp. PCC 7120: all3274Help
Entry
all3274           CDS       T00069                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00040  Pentose and glucuronate interconversions
ana00052  Galactose metabolism
ana00500  Starch and sucrose metabolism
ana00520  Amino sugar and nucleotide sugar metabolism
ana01100  Metabolic pathways
ana01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    all3274
   00052 Galactose metabolism
    all3274
   00500 Starch and sucrose metabolism
    all3274
   00520 Amino sugar and nucleotide sugar metabolism
    all3274
Enzymes [BR:ana01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     all3274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Imm65
Motif
Other DBs
NCBI-ProteinID: BAB74973
CyanoBase: all3274
CYORF: all3274
UniProt: Q8YS18
Position
complement(3947177..3948058)
Genome map
AA seq 293 aa AA seqDB search
MQINKVRKAVIPAAGFGTRLFPATKVVKKELFPIIDQDGRAKPVILAIVEEAISAGITEV
GIVVQPDDIGIFADLFKNPPAPELLQKLSPQNQEYSQYLQDLGQKVVLLTQSEQEGYGHA
VFCAKDWVGNEPFLLMLGDHVYKSDIKKSCAQQVVEIYAQVHQSVVGLTTMPAAIINKAG
CIAGVWQEFNSILELTQLAEKPNLDYAREHLRVEGMAEDEFLCVFGLYVLTPKIFDFLAD
SINQNLRDRGEFQLTNCLDKLCQAEGMTGYVVKGKCFDTGLPNTYRQSLIDFI
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattaataaagtaagaaaagccgtgattccggctgctggttttggtactagatta
tttccagctactaaagttgtgaaaaaagaactattcccaattattgatcaagatggtaga
gcaaagcctgtaattttagctattgtggaagaagctattagtgcaggaatcacagaagtt
ggtattgttgtacagcctgatgatataggaatttttgctgatttatttaaaaatccacct
gcaccagaacttttacaaaaactttcgccacaaaatcaagaatatagtcaatacttgcaa
gatttgggacagaaagttgttttattgacacaatcagaacaagaaggatatggccatgct
gttttttgtgccaaagattgggtaggaaatgaaccgtttttattaatgttaggtgatcat
gtttataaatccgacataaaaaaatcttgcgctcaacaagttgtagagatttatgcacaa
gttcatcaaagtgttgttggcttaactacaatgccagcagcgataattaacaaagctgga
tgtattgcaggagtatggcaagagtttaattccattttggaactaacgcaacttgcagaa
aaacccaatcttgattatgcgcgtgagcatttgcgggtagaaggtatggcagaagatgag
tttttatgtgtttttggcttgtatgtcctcacgccaaaaatatttgatttcctagcagat
agtataaaccaaaatttacgcgatcgcggtgaatttcagttaacaaattgtttagataaa
ttgtgtcaagcagaagggatgacaggatatgtggtgaaaggtaaatgttttgatacgggt
ctaccaaatacttatcgacagtcattaattgattttatatag

DBGET integrated database retrieval system