KEGG   Nostoc sp. PCC 7120: all4237Help
Entry
all4237           CDS       T00069                                 

Definition
(GenBank) hypothetical protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00010  Glycolysis / Gluconeogenesis
ana00260  Glycine, serine and threonine metabolism
ana00680  Methane metabolism
ana01100  Metabolic pathways
ana01110  Biosynthesis of secondary metabolites
ana01120  Microbial metabolism in diverse environments
ana01130  Biosynthesis of antibiotics
ana01200  Carbon metabolism
ana01230  Biosynthesis of amino acids
Module
ana_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    all4237
  Energy metabolism
   00680 Methane metabolism
    all4237
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    all4237
Enzymes [BR:ana01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     all4237
Membrane trafficking [BR:ana04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    all4237
Exosome [BR:ana04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   all4237
  Exosomal proteins of melanoma cells
   all4237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAB75936
CyanoBase: all4237
CYORF: all4237
UniProt: Q8YPF7
Position
complement(5073514..5073816)
Genome map
AA seq 100 aa AA seqDB search
MLPDWRDHLLKTFDDLDLCLVGGESSRAAMQRGVAVVNEILLHNTKTTIIVTHGNLMTLL
LKHFHQQIGFAEWQRLTNPDIYNVVIGNDYVEVKRIWQKS
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
gtgcttcccgattggcgtgaccatctgctcaagactttcgacgatctcgatttatgtttg
gtaggtggtgaatcaagtcgtgccgcaatgcaacggggagttgcagtagtaaatgaaatt
ttgttgcacaatactaagactacgattattgtcacgcatggtaatttaatgactctgcta
ttaaaacatttccaccagcagataggttttgctgagtggcagcgtttgacaaatccagac
atatataatgtcgtgattggcaatgattatgtagaagttaagcggatatggcagaaatcg
tga

DBGET integrated database retrieval system