KEGG   Nostoc sp. PCC 7120: all4237Help
Entry
all4237           CDS       T00069                                 

Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    all4237
   01230 Biosynthesis of amino acids
    all4237
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    all4237
  Energy metabolism
   00680 Methane metabolism
    all4237
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    all4237
Enzymes [BR:ana01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     all4237
Exosome [BR:ana04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   all4237
  Exosomal proteins of melanoma cells
   all4237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(5073514..5073816)
Genome map
AA seq 100 aa AA seqDB search
MLPDWRDHLLKTFDDLDLCLVGGESSRAAMQRGVAVVNEILLHNTKTTIIVTHGNLMTLL
LKHFHQQIGFAEWQRLTNPDIYNVVIGNDYVEVKRIWQKS
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
gtgcttcccgattggcgtgaccatctgctcaagactttcgacgatctcgatttatgtttg
gtaggtggtgaatcaagtcgtgccgcaatgcaacggggagttgcagtagtaaatgaaatt
ttgttgcacaatactaagactacgattattgtcacgcatggtaatttaatgactctgcta
ttaaaacatttccaccagcagataggttttgctgagtggcagcgtttgacaaatccagac
atatataatgtcgtgattggcaatgattatgtagaagttaagcggatatggcagaaatcg
tga

DBGET integrated database retrieval system