KEGG   Nostoc sp. PCC 7120: all4257Help
Entry
all4257           CDS       T00069                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    all4257
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    all4257
   00620 Pyruvate metabolism
    all4257
   00640 Propanoate metabolism
    all4257
  Energy metabolism
   00680 Methane metabolism
    all4257
Enzymes [BR:ana01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     all4257
Lipid biosynthesis proteins [BR:ana01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   all4257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(5106361..5107935)
Genome map
AA seq 524 aa AA seqDB search
MSQPTIESILQEKRLFPPSTEFSQNAQIKSLEDYQRLYDKAKADPQKFWAELAETELHWF
QKWDTVLDWQAPFAKWFVGGKINISYNCLDRHLTTWRKNKAALIWEGEPGDSRTLTYAQL
HREVCQFANVLKQLGVQKGDRVGIYMPMIPEAAIAMLACARIGAPHSVVFGGFSAEALRD
RLIDAQAKVVVTADGGWRKDAIVPLKEQVDKALADDAVPSVENVLVVKRTGQDIYMQLGG
RDHWWHDLQKGASADCPAEPMDSEDLLFVLYTSGSTGKPKGVVHTTGGYNLYTHMTTKWI
FDLQDTDVYWCTADVGWITGHSYIVYGPLSNGATTLMYEGAPRASNPGCFWDVIEKYGVN
IFYTAPTAIRAFIKMGEHHPNARNLSSLRLLGTVGEPINPEAWMWYHKVIGGERCPIVDT
WWQTETGGIMITPLPGAISTKPGSATLPFPGILADIVDLEGNTVPENEGGYLAVRYPWPG
MMRTVYGDPERFRRTYWEHIPPKMGIILTLPAMVQEKMKTAISG
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagccaactatagagtcaattctgcaagaaaaacgtttatttcctcccagtacc
gagttttcccaaaatgcccagattaaaagtctagaagattaccaacgtctttatgacaaa
gccaaagctgatccgcaaaaattttgggcagaattagccgaaacagaattgcactggttc
caaaaatgggacacagtactagattggcaagcaccttttgctaagtggttcgtgggtggg
aagattaacatttcctacaactgtttagatagacatctcacaacctggcggaaaaataaa
gccgcgttgatttgggaaggggaaccaggagattcccgtactttaacttatgcccaattg
catcgggaagtttgccagttcgccaacgtcttgaaacaactgggagtgcagaaaggcgat
cgcgtcggtatttatatgccgatgataccggaagccgcgatcgctatgttagcctgtgcc
agaattggcgcgcctcatagtgtggtatttggtgggtttagtgcggaagcattgcgcgat
cgcttaattgatgcccaagccaaggtagtagttacagctgatggtggttggcgtaaagat
gcgatcgttcccttgaaagaacaggtagacaaagccttggctgatgacgctgttcccagt
gtggagaatgtcctggttgtcaagcgtaccggacaagatatttatatgcagttgggagga
cgagatcattggtggcacgatttacaaaaaggtgcatcggcagattgtcccgccgaacca
atggacagcgaggatttactctttgtcctctacacttctggtagcacaggcaaacccaaa
ggtgttgtccacaccactggcggttataacctatatactcacatgaccaccaaatggatt
ttcgacctacaagacacagatgtatattggtgtactgccgatgtaggctggattaccgga
cacagttacattgtttacggccccctctccaacggtgcaaccactctgatgtatgaaggt
gcgcctcgtgcctctaatcctgggtgtttctgggatgtaattgaaaaatacggcgtgaat
attttctacaccgcacccaccgcaattcgcgccttcattaaaatgggcgaacaccatccc
aacgcccgtaatctttcttctttaagattattaggaaccgtcggcgaacccatcaaccca
gaagcttggatgtggtatcacaaagtaattggtggtgaacgctgccccatagttgatact
tggtggcaaacggaaactggcggtatcatgattacgcctctaccaggggcaatttccact
aaacccggttccgctacccttcccttccccggcatcctggccgacatcgttgatttagaa
ggtaacactgtaccggaaaacgaaggtggttacttagcagtgcgttatccctggcctggg
atgatgcggactgtctacggcgatccggaacgcttccgccgcacctactgggaacacatc
cccccaaagatgggaattatacttactttgccggcgatggtgcaagaaaagatgaagacg
gctatttctgggtaa

DBGET integrated database retrieval system