KEGG   Nostoc sp. PCC 7120: all4257Help
Entry
all4257           CDS       T00069                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ana  Nostoc sp. PCC 7120
Pathway
ana00010  Glycolysis / Gluconeogenesis
ana00620  Pyruvate metabolism
ana00640  Propanoate metabolism
ana00680  Methane metabolism
ana01100  Metabolic pathways
ana01110  Biosynthesis of secondary metabolites
ana01120  Microbial metabolism in diverse environments
ana01130  Biosynthesis of antibiotics
ana01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    all4257
   00620 Pyruvate metabolism
    all4257
   00640 Propanoate metabolism
    all4257
  Energy metabolism
   00680 Methane metabolism
    all4257
Enzymes [BR:ana01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     all4257
Lipid biosynthesis proteins [BR:ana01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   all4257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N
Motif
Other DBs
NCBI-ProteinID: BAB75956
CyanoBase: all4257
CYORF: all4257
UniProt: Q8YPE0
Position
complement(5106361..5107935)
Genome map
AA seq 524 aa AA seqDB search
MSQPTIESILQEKRLFPPSTEFSQNAQIKSLEDYQRLYDKAKADPQKFWAELAETELHWF
QKWDTVLDWQAPFAKWFVGGKINISYNCLDRHLTTWRKNKAALIWEGEPGDSRTLTYAQL
HREVCQFANVLKQLGVQKGDRVGIYMPMIPEAAIAMLACARIGAPHSVVFGGFSAEALRD
RLIDAQAKVVVTADGGWRKDAIVPLKEQVDKALADDAVPSVENVLVVKRTGQDIYMQLGG
RDHWWHDLQKGASADCPAEPMDSEDLLFVLYTSGSTGKPKGVVHTTGGYNLYTHMTTKWI
FDLQDTDVYWCTADVGWITGHSYIVYGPLSNGATTLMYEGAPRASNPGCFWDVIEKYGVN
IFYTAPTAIRAFIKMGEHHPNARNLSSLRLLGTVGEPINPEAWMWYHKVIGGERCPIVDT
WWQTETGGIMITPLPGAISTKPGSATLPFPGILADIVDLEGNTVPENEGGYLAVRYPWPG
MMRTVYGDPERFRRTYWEHIPPKMGIILTLPAMVQEKMKTAISG
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagccaactatagagtcaattctgcaagaaaaacgtttatttcctcccagtacc
gagttttcccaaaatgcccagattaaaagtctagaagattaccaacgtctttatgacaaa
gccaaagctgatccgcaaaaattttgggcagaattagccgaaacagaattgcactggttc
caaaaatgggacacagtactagattggcaagcaccttttgctaagtggttcgtgggtggg
aagattaacatttcctacaactgtttagatagacatctcacaacctggcggaaaaataaa
gccgcgttgatttgggaaggggaaccaggagattcccgtactttaacttatgcccaattg
catcgggaagtttgccagttcgccaacgtcttgaaacaactgggagtgcagaaaggcgat
cgcgtcggtatttatatgccgatgataccggaagccgcgatcgctatgttagcctgtgcc
agaattggcgcgcctcatagtgtggtatttggtgggtttagtgcggaagcattgcgcgat
cgcttaattgatgcccaagccaaggtagtagttacagctgatggtggttggcgtaaagat
gcgatcgttcccttgaaagaacaggtagacaaagccttggctgatgacgctgttcccagt
gtggagaatgtcctggttgtcaagcgtaccggacaagatatttatatgcagttgggagga
cgagatcattggtggcacgatttacaaaaaggtgcatcggcagattgtcccgccgaacca
atggacagcgaggatttactctttgtcctctacacttctggtagcacaggcaaacccaaa
ggtgttgtccacaccactggcggttataacctatatactcacatgaccaccaaatggatt
ttcgacctacaagacacagatgtatattggtgtactgccgatgtaggctggattaccgga
cacagttacattgtttacggccccctctccaacggtgcaaccactctgatgtatgaaggt
gcgcctcgtgcctctaatcctgggtgtttctgggatgtaattgaaaaatacggcgtgaat
attttctacaccgcacccaccgcaattcgcgccttcattaaaatgggcgaacaccatccc
aacgcccgtaatctttcttctttaagattattaggaaccgtcggcgaacccatcaaccca
gaagcttggatgtggtatcacaaagtaattggtggtgaacgctgccccatagttgatact
tggtggcaaacggaaactggcggtatcatgattacgcctctaccaggggcaatttccact
aaacccggttccgctacccttcccttccccggcatcctggccgacatcgttgatttagaa
ggtaacactgtaccggaaaacgaaggtggttacttagcagtgcgttatccctggcctggg
atgatgcggactgtctacggcgatccggaacgcttccgccgcacctactgggaacacatc
cccccaaagatgggaattatacttactttgccggcgatggtgcaagaaaagatgaagacg
gctatttctgggtaa

DBGET integrated database retrieval system