KEGG   Nostoc sp. PCC 7120: all4365Help
Entry
all4365           CDS       T00069                                 

Gene name
chlH
Definition
magnesium chelatase subunit H (EC:6.6.1.1)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    all4365 (chlH)
Enzymes [BR:ana01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     all4365 (chlH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(5225917..5229903)
Genome map
AA seq 1328 aa AA seqDB search
MFTHVKSTIRHIAPDNLRGRNLIKVVYVVLESQYQSALSQAVRTINANNPNLAIEISGYL
IEELRDPENYEEFKREIEGANIFIASLIFIEDLAQKVVAAVEPHRDRLDVAVVFPSMPEV
MRLNKMGSFSLAQLGQSKSAIAQFMRKRKEKSGAGFQDGMLKLLRTLPQVLKYLPVEKAQ
DARNFMLSFQYWLGGSPENLENFLLMLTDKYVLKAVEKQNSASVEYEAPVVYPDLGIWHP
LAPSMFEDVREYLNWYTARKDISSDLKDPLAPCVGLVLQRTHLVTGDDAHYVAMVQELEA
LGARVLPVFAGGLDFSKPVDAYFYEPTTKTPLVDAVISLTGFALVGGPARQDHPKAIDAL
KRLNRPYMVALPLVFQTTEEWLDSDLGLHPIQVALQIAIPELDGAIEPIILSGRDGTTGK
AIALQDRIAAVAQRALKWANLRRKPKLNKKVAITVFSFPPDKGNVGTAAYLDVFGSIYEV
MQALRNNGYDVQDLPENAQELMEQVIHDAQAQYASPELNIAYKMSVPEYEELTPYSQRLE
ENWGPPPGNLNSDGQNLLIYGKQFGNVFIGVQPTFGYEGDPMRLLFSRSASPHHGFAAYY
TYLERVWGADAVLHFGTHGSLEFMPGKQMGMSGECYPDNLIGTIPNLYYYAANNPSEATI
AKRRSYAETISYLTPPAENAGLYKGLKELSELIASYQTLKDSGRGIPIVNTIMDKCRIVN
LDKDINLPETDAKDMTPEERDNIVGSVYRKLMEIESRLLPCGLHVIGKPPTAEEAIATLV
NIASLDRQEEEILSLPRIIANSLGRDIDEIYQNNDRGILEDVQLLQDITLATRAAVRALV
EEQTNAEGRVSLVSKLNFFNMGKKEPWVESLHQSGYPKVDTSALKPLFEYLEFCLQQVCA
DNELGALLKGLEGEYILPGPGGDPIRNPDVLPTGKNIHALDPQSIPTAAAVQSAKIVVDR
LLARNKADNNGNWPETIACVLWGTDNIKTYGESLAQIMWMVGVRPVPDALGRVNKLELIP
LEELGRPRIDVVINCSGVFRDLFINQMNLLDQGVKMAAEADEPLEMNFVRKHALQQAEEM
GINLRQAATRVFSNASGSYSSNINLAVENSTWDSEAELQEMYLKRKSFSFNSDNPGMMDE
SRQLFESTLKTADATFQNLDSSEISLTDVSHYFDSDPTKLVASLRGDGKKPSSYIADTTT
ANAQVRTLSETVRLDARTKLLNPKWYEGMLSHGYEGVRELSKRLVNTTGWSATAGAVDNW
IYEDTNETFIKDEEMQKRLLNLNPHSFRKIVSTLLEVNGRGYWETSEENLDRLRELYQEV
EDRIEGIE
NT seq 3987 nt NT seq  +upstreamnt  +downstreamnt
atgttcacccacgtcaagtccaccattagacacattgcgcctgataacctgcgcggacgt
aatttaattaaggtggtctatgtcgtgcttgagtcccagtaccagagcgcactgtcgcaa
gcggttcgcacgattaacgcgaataatcccaacctggcgattgaaatcagtgggtatttg
attgaggaactgagagatccagagaactacgaagagttcaagcgggagatcgagggtgcc
aatattttcatcgcttcattgattttcatcgaagacttagcacagaaagtagttgcagca
gtagaaccacaccgcgatcgcttagacgttgccgttgtctttccctcgatgccagaagtt
atgcgcctgaacaagatgggcagcttttctctggcacagttgggacagtcgaaaagtgcg
atcgcccaatttatgcggaaacgcaaagaaaaatccggtgcgggattccaagatgggatg
ctgaagttattgcgaaccttgccgcaagtactgaagtatttaccagtggagaaagcacag
gacgctcgcaattttatgttgagctttcagtattggctaggaggttcaccagaaaatctg
gaaaacttcttgctgatgctaactgataaatatgtattaaaagcagtagaaaaacagaat
tctgcatccgtagaatatgaagcgccagttgtatatcctgatttggggatttggcatcct
ttagcgccgagtatgtttgaggatgtcagagaatacctcaactggtacacagcccgtaag
gatatatccagcgatttaaaagatcccttagcaccctgtgtagggttggtattacaacgc
actcacctagttaccggtgatgatgcccattatgtggcaatggtgcaggagttggaagcc
ttaggggcaagggtattgccagtttttgcaggtggtctggatttctccaagcctgtggat
gcttacttttacgaaccaacgactaaaaccccgttagtagatgcagtgatctctctcact
ggttttgcgttggtgggtggcccggctagacaagaccatcctaaagcaattgacgcactt
aaacgcctgaatcgtccttatatggtggcattgcctttagtcttccaaacgactgaagaa
tggttggatagcgatttaggcttacatccgattcaggtggctttgcagattgccattccc
gaactagatggggcaattgaaccgattatattatcgggtagagatggcacaacaggaaaa
gcgatcgccttacaagaccgtatcgccgcagttgctcaacgcgctttaaaatgggctaac
ctgcgccgcaaacccaaactcaacaaaaaagttgctatcacagttttcagtttcccacct
gataaaggtaatgtcgggacggctgcttacttagatgtatttggttccatctacgaagta
atgcaggctttgagaaacaacggctacgatgtgcaggacttaccagaaaacgctcaagag
ttgatggaacaagtcatccacgacgcacaagcacagtatgctagcccggaactcaacatt
gcttataagatgtcagtcccagaatatgaggaactaacaccttattcccaacgcctagaa
gaaaactgggggccaccaccaggaaacctcaacagcgacggacaaaacctgttaatttac
ggtaagcaatttggtaacgtcttcattggtgtacaacccacctttggttacgaaggcgac
cccatgcggttgttgttctcccgttctgctagtcctcaccacggctttgctgcttactac
acttacctagaaagagtttggggtgctgatgctgtactgcacttcggtacacacggttcc
ttggaatttatgccaggtaagcaaatggggatgtctggtgaatgttacccagataactta
attggcacaattcccaacctgtactattacgcagccaataaccccagcgaagcgacaatt
gctaaacgccgcagttacgctgagacaatttcttacctaacaccacctgcggaaaacgct
ggtttgtacaaaggtttgaaagaactcagtgagttaattgcgtcttaccaaaccttaaaa
gatagcggtcgtggtatccccatcgtcaacacgatcatggataaatgccgcatcgtcaac
ctggataaagatattaacttgccagaaaccgatgccaaagatatgacccccgaagaacgg
gataatattgtcggcagcgtttaccgcaagttgatggaaatcgaatcccggttattacct
tgtggtttgcacgtcattggtaaacccccaacggcagaggaagcgatcgccacactagtc
aacattgccagcttagaccgtcaagaagaagaaattctcagcttaccccggatcatcgct
aacagcctggggcgcgacattgacgaaatttaccaaaataacgacagaggcatactagaa
gatgtccaattactacaagacatcaccctagccacccgcgccgccgtccgcgccttggta
gaagaacaaaccaacgcagaaggacgagtttccctcgtttccaagttgaatttcttcaac
atgggcaaaaaagaaccttgggtagaatccctgcatcaatcaggttatcccaaagttgac
acctcagccttaaaacccctgttcgagtatttagaattctgcttacaacaagtttgtgca
gacaacgaactcggcgcattactcaaaggcttagaaggcgaatacatattacccggccct
ggtggagaccccatccgcaacccagatgtattacccacaggtaaaaacatccacgccctc
gacccccaatcaatccccacagccgccgccgtccaatcagccaaaattgtcgtagatcgg
ctattggcacggaacaaagctgacaacaatggtaattggccagaaaccatcgcctgcgtc
ctttggggaacggataacatcaaaacctatggcgaatccctagcccaaatcatgtggatg
gttggtgtacgtccggttcccgatgctttgggacgggtgaacaagttggagttaataccc
ctagaagagttgggacgacccagaattgacgtagtaattaactgttctggcgtattccgc
gacttgttcattaaccagatgaacttgttagaccaaggggtgaagatggcggcggaagcg
gatgaaccattagaaatgaacttcgtccgcaaacacgcactgcaacaagctgaggaaatg
ggtattaacctcagacaagcagccacccgcgtgttctccaacgcttctggttcctactcc
tcaaacataaacttggcagtagaaaacagcacatgggatagcgaagccgaattacaggaa
atgtacctcaagcgcaaatccttctccttcaattccgataaccccggaatgatggacgaa
tcccgccagctttttgaaagcaccttaaaaactgctgacgcaaccttccaaaacctggat
tcctccgagattagcttgactgacgtttcccactacttcgactcagaccccaccaagttg
gtagcaagtctgcgtggtgatggaaagaaaccttcatcctacattgcagacaccaccaca
gctaacgcccaagtccgcacattatccgaaaccgtccgcctagatgctcgtaccaaattg
ttaaatcccaagtggtatgaaggtatgctatctcacggttacgaaggtgtccgcgaactc
tccaagcggttggtaaataccacaggttggagtgcgacagccggcgcagtcgataactgg
atttatgaggatactaacgaaaccttcattaaagatgaagaaatgcagaaacggttactt
aaccttaacccccattctttccgcaagattgtctcaactttgttggaagtgaatggtcgt
ggttattgggaaactagcgaggagaatttagaccgcctccgcgagttgtaccaagaagtt
gaagaccggattgaaggcatagaatag

DBGET integrated database retrieval system