KEGG   Anabaena sp. PCC7120: all4991Help
Entry
all4991           CDS       T00069                                 

Gene name
desC
Definition
delta-9 desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ana  Anabaena sp. PCC7120
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ana01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ana01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(5963080..5963937)
Genome map
AA seq 285 aa AA seqDB search
MTVKHLAIAPEGKKSLRLSWTNVAFFTTIHALALLAPWFFSWSALGLLLFLHWLFGSIGI
CLGYHRLLSHKSFQVPKWLEYAIATIGALAMQGGPIFWIGGHRQHHAHTEDVYLDPYSSQ
RGFWWSHMLWILYPRSEFFDYEIYQKYAPDLARQPFYRWLDRYFLLLQIPFGLMLYAIGG
WSFVIYGVVLRAVLLWHSTWFVNSATHMWGYRTFNADDNARNLWWVSIVTYGEGWHNNHH
TYPNVAKAGFQWWEVDVTWWSIKLLQTLGLAKKVVLPPSQRMNQG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtaaaacatctggcaatcgcccctgaggggaagaagtcattgcgcctcagttgg
acaaacgtggcattttttaccacaattcacgctctagctttgttggctccttggtttttt
tcctggtcagcattgggtttgctgttgtttctccactggttgtttggcagtattggtatt
tgccttgggtaccacagattacttagtcacaagagttttcaagtacccaaatggctggaa
tatgcgatcgccactatcggtgcattggctatgcagggagggccaattttttggattgga
ggacatcgccagcatcatgctcacaccgaagatgtctatctagatccatactcttcccag
cgtggattttggtggagccatatgttgtggattttatatcctcgctccgaatttttcgac
tatgaaatctatcaaaagtatgcgcctgatttagcaagacaaccattctatcgttggtta
gatcgttattttctcctgttgcaaattccttttggattaatgctttacgctatcggagga
tggtctttcgtcatctatggtgtagttctcagagcagtattgctatggcactctacttgg
tttgtcaactctgccacccatatgtggggctatcgtacctttaacgctgatgataatgca
cgtaatttgtggtgggtatctatagtaacctatggcgaaggttggcacaacaaccatcac
acttaccccaacgtagccaaagctgggttccagtggtgggaagttgatgtcacttggtgg
agtattaaactgttgcagactttaggtttggcgaagaaagtagttttaccgccatcacaa
agaatgaatcaaggttga

DBGET integrated database retrieval system