KEGG   Nostoc sp. PCC 7120: all4991Help
Entry
all4991           CDS       T00069                                 

Gene name
desC
Definition
delta-9 desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    all4991 (desC)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    all4991 (desC)
Enzymes [BR:ana01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     all4991 (desC)
Lipid biosynthesis proteins [BR:ana01004]
 Desaturase
  First
   all4991 (desC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(5963080..5963937)
Genome map
AA seq 285 aa AA seqDB search
MTVKHLAIAPEGKKSLRLSWTNVAFFTTIHALALLAPWFFSWSALGLLLFLHWLFGSIGI
CLGYHRLLSHKSFQVPKWLEYAIATIGALAMQGGPIFWIGGHRQHHAHTEDVYLDPYSSQ
RGFWWSHMLWILYPRSEFFDYEIYQKYAPDLARQPFYRWLDRYFLLLQIPFGLMLYAIGG
WSFVIYGVVLRAVLLWHSTWFVNSATHMWGYRTFNADDNARNLWWVSIVTYGEGWHNNHH
TYPNVAKAGFQWWEVDVTWWSIKLLQTLGLAKKVVLPPSQRMNQG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtaaaacatctggcaatcgcccctgaggggaagaagtcattgcgcctcagttgg
acaaacgtggcattttttaccacaattcacgctctagctttgttggctccttggtttttt
tcctggtcagcattgggtttgctgttgtttctccactggttgtttggcagtattggtatt
tgccttgggtaccacagattacttagtcacaagagttttcaagtacccaaatggctggaa
tatgcgatcgccactatcggtgcattggctatgcagggagggccaattttttggattgga
ggacatcgccagcatcatgctcacaccgaagatgtctatctagatccatactcttcccag
cgtggattttggtggagccatatgttgtggattttatatcctcgctccgaatttttcgac
tatgaaatctatcaaaagtatgcgcctgatttagcaagacaaccattctatcgttggtta
gatcgttattttctcctgttgcaaattccttttggattaatgctttacgctatcggagga
tggtctttcgtcatctatggtgtagttctcagagcagtattgctatggcactctacttgg
tttgtcaactctgccacccatatgtggggctatcgtacctttaacgctgatgataatgca
cgtaatttgtggtgggtatctatagtaacctatggcgaaggttggcacaacaaccatcac
acttaccccaacgtagccaaagctgggttccagtggtgggaagttgatgtcacttggtgg
agtattaaactgttgcagactttaggtttggcgaagaaagtagttttaccgccatcacaa
agaatgaatcaaggttga

DBGET integrated database retrieval system