KEGG   Nostoc sp. PCC 7120: all5002Help
Entry
all5002           CDS       T00069                                 

Definition
sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ana  Nostoc sp. PCC 7120
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ana00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    all5002
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    all5002
   00052 Galactose metabolism
    all5002
   00500 Starch and sucrose metabolism
    all5002
   00520 Amino sugar and nucleotide sugar metabolism
    all5002
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    all5002
   00524 Butirosin and neomycin biosynthesis
    all5002
Enzymes [BR:ana01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     all5002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(5974840..5975775)
Genome map
AA seq 311 aa AA seqDB search
MTSAVVVWCEELNVGNSQVIGIDLGGTAIKLGRFSKDGTCSQSLTVATPQPATPEAVFLV
MVDAIAQIDPDNETIAIGVGTPGPADAQGRIAQIAINLPQWENVPLADWLEAKTNKPTVI
ENDANCAGIAEAWLGAGRHCQNFIMLTLGTGVGGAIFLDGKLFVGHRGAAGELGLITLQP
DGPMCKSGNPGSLEQYTSIKAIRRLTGKEPAELGMLAQAGDPEALQFWQEYGQNLGIGLT
SLIYVLTPQAIVLGGGVSASCEFFLPTLKAEIEKRVMSTSRAGLQILPAELGNSAGMVGA
ARLAWEKFGNW
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgctgtggtggtttggtgtgaggaattgaatgtggggaattctcaagtaatt
ggcattgacttggggggaacagcaattaaattggggcgatttagcaaagatgggacttgt
tcacaatctttgactgtggcgactccccaaccagcaaccccggaagcggtttttctggtc
atggtggatgcgatcgcgcaaattgacccagataatgaaactatagctattggtgtgggt
actcctggcccggctgatgctcaaggacgcattgctcaaattgctattaacttaccgcaa
tgggaaaatgtacctttggcggattggttagaagcgaaaactaacaagccgacagtaatt
gaaaatgatgccaactgtgcgggaatcgctgaggcttggttaggagccggtcgccactgc
caaaactttatcatgttaactttggggactggtgttggtggcgcaatttttttagatggc
aaattatttgtcggacatcgtggcgcagctggtgaactgggactaattacactccaaccc
gatggccctatgtgtaaaagcggcaaccctggttctttagagcagtacacttccattaaa
gctattcgtcgcctgactggtaaagaacctgcggaattaggtatgctagctcaagctgga
gatccagaagccttacaattttggcaagaatacggacaaaatttaggtataggtttaacg
agtttaatttatgttctcacaccacaggcgatcgtgcttggcggtggtgtaagtgccagc
tgtgaatttttcttaccaactctcaaagccgaaatcgaaaagcgagttatgtccacatct
cgcgcagggttacaaatcttgccagcagagttaggtaactcagccggaatggtaggcgca
gcaagattagcttgggaaaagtttggtaattggtaa

DBGET integrated database retrieval system